Name :
MFAP2 (Human) Recombinant Protein

Biological Activity :
Human MFAP2 (NP_002394, 18 a.a. – 183 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.

Tag :

Protein Accession No. :

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=4237

Amino Acid Sequence :
MGSSHHHHHHSSGLVPRGSHMGSMQGQYDLDPLPPFPDHVQYTHYSDQIDNPDYYDYQEVTPRPSEEQFQFQSQQQVQQEVIPAPTPEPGNAELEPTEPGPLDCREEQYPCTRLYSIHRPCKQCLNEVCFYSLRRVYVINKEICVRTVCAHEELLRADLCRDKFSKCGVMASSGLCQSVAASCARSCGSC

Molecular Weight :
21.5

Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.

Host :
Escherichia coli

Interspecies Antigen Sequence :

Preparation Method :
Escherichia coli expression system

Purification :

Quality Control Testing :
3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed.

Storage Buffer :
In 20 mM Tris-HCl buffer, pH 8.0 (1 M Urea, 20% glycerol).

Applications :
SDS-PAGE,

Gene Name :
MFAP2

Gene Alias :
MAGP, MAGP-1, MAGP1

Gene Description :
microfibrillar-associated protein 2

Gene Summary :
Microfibrillar-associated protein 2 is a major antigen of elastin-associated microfibrils and a candidate for involvement in the etiology of inherited connective tissue diseases. Four transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq

Other Designations :
OTTHUMP00000002397

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
KGF/FGF-7 Proteinsite
IL-15 Recombinant Proteins
Popular categories:
ADAM10
Complement Factor H Related 4