Name :
Csf3 (Mouse) Recombinant Protein
Biological Activity :
Mouse Csf3 (P09920, 31 a.a. – 208 a.a.) partial recombinant protein expressed in CHO cells.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins
Tag :
Protein Accession No. :
P09920
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=12985
Amino Acid Sequence :
VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA
Molecular Weight :
22 ~ 24
Storage and Stability :
Store at 4°C for 1 week. For long term storage store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
Human
Interspecies Antigen Sequence :
Preparation Method :
_x005f
_x005f
Mammalian cell (CHO) expression system_x005f
_x005f
Purification :
Quality Control Testing :
Storage Buffer :
Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O OR PBS up to 100 ug/mL.
Applications :
Functional Study, SDS-PAGE,
Gene Name :
Csf3
Gene Alias :
Csfg, G-CSF, MGI-IG
Gene Description :
colony stimulating factor 3 (granulocyte)
Gene Summary :
Other Designations :
OTTMUSP00000006785|colony stimulating factor 3
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-12 site
Cathepsin S ProteinMedChemExpress
Popular categories:
CD236/Glycophorin C
Acid Phosphatase