Name :
FHL2 (Human) Recombinant Protein
Biological Activity :
Human FHL2 (NP_001034581, 1 a.a. – 279 a.a ) full-length recombinant protein with His tag expressed in Escherichia coli.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength
Tag :
Protein Accession No. :
Q14192
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=2274
Amino Acid Sequence :
MGSSHHHHHHSSGLVPRGSHMGSMTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI
Molecular Weight :
34.6
Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Quality Control Testing :
3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain. SDS-PAGE analysis of FHL2 (Human) Recombinant Protein
Storage Buffer :
In 20 mM Tris-HCl buffer, pH 8.0 (10% glycerol).
Applications :
SDS-PAGE，
Gene Name :
FHL2
Gene Alias :
AAG11, DRAL, SLIM3
Gene Description :
four and a half LIM domains 2
Gene Summary :
LIM proteins contain a highly conserved double zinc finger motif called the LIM domain.[supplied by OMIM
Other Designations :
aging-associated gene 11|down-regulated in rhabdomyosarcoma LIM protein|four and a half LIM-domain protein 2
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-10 ProteinMedChemExpress
CD38 medchemexpress
Popular categories:
M-CSF
CCL12