Name :
PDGFa (Rat) Recombinant Protein
Biological Activity :
Rat PDGFa (P28576) recombinant protein expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins
Tag :
Protein Accession No. :
P28576
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=25266
Amino Acid Sequence :
MSIEEAIPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNPDHREEETDVR.
Molecular Weight :
25.3
Storage and Stability :
Store at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Quality Control Testing :
Storage Buffer :
Lyophilized from PBS, pH7.0.
Applications :
Functional Study， SDS-PAGE，
Gene Name :
PDGFa
Gene Alias :
PDGFACP
Gene Description :
platelet-derived growth factor alpha polypeptide
Gene Summary :
alpha
Other Designations :
Platelet-derived growth factor A chain|platelet derived growth factor, alpha
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-3 Proteinmedchemexpress
Fibroblast Growth Factor Recombinant Proteins
Popular categories:
ADAM17/TACE
Serpin (Protease Inhibitor)