Name :
CD86 (Human) Recombinant Protein
Biological Activity :
Human CD86 partial recombinant protein with His tag in C-terminus expressed in Baculovirus cells.
Tag :
Protein Accession No. :
P42081
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=942
Amino Acid Sequence :
YFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGIMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIPHHHHHH
Molecular Weight :
25.6
Storage and Stability :
Store at 4°C for one weeks and should be stored at -20°C to -80°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid repeated freeze/thaw cycles.
Host :
Viruses
Interspecies Antigen Sequence :
Preparation Method :
Baculovirus expression system
Purification :
chromatographic
Quality Control Testing :
Storage Buffer :
Solution (0.5 mg/mL) containing 1X PBS, pH 7.4, 10% glycerol.
Applications :
SDS-PAGE，
Gene Name :
CD86
Gene Alias :
B7-2, B70, CD28LG2, LAB72, MGC34413
Gene Description :
CD86 molecule
Gene Summary :
This gene encodes a type I membrane protein that is a member of the immunoglobulin superfamily. This protein is expressed by antigen-presenting cells, and it is the ligand for two proteins at the cell surface of T cells, CD28 antigen and cytotoxic T-lymphocyte-associated protein 4. Binding of this protein with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of this protein with cytotoxic T-lymphocyte-associated protein 4 negatively regulates T-cell activation and diminishes the immune response. Alternative splicing results in two transcript variants encoding different isoforms. Additional transcript variants have been described, but their full-length sequences have not been determined. [provided by RefSeq
Other Designations :
B-lymphocyte activation antigen B7-2|B7-2 antigen|CD28 antigen ligand 2|CD86 antigen|CD86 antigen (CD28 antigen ligand 2, B7-2 antigen)|CTLA-4 counter-receptor B7.2
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
SARS-CoV-2 RNA Dependent RNA Polymerase site
Protein tyrosine phosphatases Recombinant Proteins
Popular categories:
Carbonic Anhydrase 8 ( CA-VIII)
IL-5 Receptor α