HOXA1 (Human) Recombinant Protein (Q01)
Name : HOXA1 (Human) Recombinant Protein (Q01)Biological Activity : Human HOXA1 partial ORF ( NP_005513.1, 11 a.a. - 119 a.a.) recombinant protein with GST-tag at N-terminal.Tag : Best use within…
Influenza A H5N1 (A/goose/Guangdong/1/1996) Hemagglutinin/HA Protein (His)
Name : Influenza A H5N1 (A/goose/Guangdong/1/1996) Hemagglutinin/HA Protein (His)Description : The influenza viral Hemagglutinin (HA) protein is a homotrimer with a receptor binding pocket on the globular head of each…
Influenza A H1N1 (A/Ohio/UR06-0091/2007) Hemagglutinin/HA Protein (His)
Name : Influenza A H1N1 (A/Ohio/UR06-0091/2007) Hemagglutinin/HA Protein (His)Description : The influenza viral Hemagglutinin (HA) protein is a homotrimer with a receptor binding pocket on the globular head of each…
HLA-E (Human) Recombinant Protein (P01)
Name : HLA-E (Human) Recombinant Protein (P01)Biological Activity : Human HLA-E full-length ORF (no protein_acc, 1 a.a. - 358 a.a.) recombinant protein with GST tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag…
Influenza A H1N1 (A/California/06/2009) Hemagglutinin/HA1 Protein (His)
Name : Influenza A H1N1 (A/California/06/2009) Hemagglutinin/HA1 Protein (His)Description : The influenza viral Hemagglutinin (HA) protein is a homotrimer with a receptor binding pocket on the globular head of each…
GSTM4 (Human) Recombinant Protein (Q03)
Name : GSTM4 (Human) Recombinant Protein (Q03)Biological Activity : Human GSTM4 partial ORF ( AAH15513.1, 23 a.a. - 119 a.a.) recombinant protein with GST-tag at N-terminal.Tag : Best use within…
IL-23R Protein
Name : IL-23R ProteinDescription : Interleukin 23 (IL-23) is a heterodimeric cytokine composed of two disulfide-linked subunits, a p19 subunit that is unique to IL-23, and a p40 subunit that…
GNG5 (Human) Recombinant Protein (P01)
Name : GNG5 (Human) Recombinant Protein (P01)Biological Activity : Human GNG5 full-length ORF ( AAH03563, 1 a.a. - 68 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
IL-1 alpha/IL-1A Protein
Name : IL-1 alpha/IL-1A ProteinDescription : IL-1 alpha is a member of the interleukin 1 cytokine family. Cytokines are proteinaceous signaling compounds that are major mediators of the immune response.…
IL10RA (Human) Recombinant Protein
Name : IL10RA (Human) Recombinant ProteinBiological Activity : Human IL10RA (Q13651, His22-Asn235) partial recombinant protein with His-Avi tag at C-Terminus expressed in HEK293 cells.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins,Recombinant Human Protein,Recombinant…
Simian immunodeficiency virus (SIV) (isolate SIVmac251v31523ru28) gp120 Protein (His)
Name : Simian immunodeficiency virus (SIV) (isolate SIVmac251v31523ru28) gp120 Protein (His)Description : Species : SIVUniprotkb : HEK293Tag : HisSynonyms : SIV-GP12Construction : A DNA sequence encoding the Simian immunodeficiency virus…
ROBO4 (Human) Recombinant Protein
Name : ROBO4 (Human) Recombinant ProteinBiological Activity : Human ROBO4 (Q8WZ75-1, Ala27-Glu469) partial recombinant protein with His tag at C-Terminus expressed in HEK293 cells.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins,Recombinant Human Protein,Recombinant…
IgG2a Protein
Name : IgG2a ProteinDescription : Species : MouseUniprotkb : HEK293Tag : Tag FreeSynonyms : IgG2a-Fc, Igh-1, 1816O9RikConstruction : A DNA sequence encoding the Mouse IgG2a Fc region (P01863) (Glu98-Lys330) was…
CD33 (Human) Recombinant Protein
Name : CD33 (Human) Recombinant ProteinBiological Activity : Human CD33 (P20138, 18 a.a. - 259 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.Tag : Protein…
CCL15 (Human) Recombinant Protein
Name : CCL15 (Human) Recombinant ProteinBiological Activity : Human CCL15 (Q16663, 46 a.a. - 113 a.a.) partial recombinant protein expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional ProteinsTag : Protein Accession…
CD86 (Human) Recombinant Protein
Name : CD86 (Human) Recombinant ProteinBiological Activity : Human CD86 partial recombinant protein with His tag in C-terminus expressed in Baculovirus cells.Tag : Protein Accession No. : P42081Protein Accession No.URL…
CD80 (Human) Recombinant Protein
Name : CD80 (Human) Recombinant ProteinBiological Activity : Human CD80 (P33681, 35 a.a. - 242 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in Baculovirus.Tag : Protein Accession…
Pdgfa (Rat) Recombinant Protein
Name : PDGFa (Rat) Recombinant ProteinBiological Activity : Rat PDGFa (P28576) recombinant protein expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional ProteinsTag : Protein Accession No. : P28576Protein Accession No.URL :…
CD58 (Human) Recombinant Protein
Name : CD58 (Human) Recombinant ProteinBiological Activity : Human CD58 (P19256) recombinant protein expressed in in CHO cells.Tag : Protein Accession No. : P19256Protein Accession No.URL : https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=965Amino Acid Sequence…
HGF (Human) Recombinant Protein
Name : HGF (Human) Recombinant ProteinBiological Activity : Human HGF partial recombinant protein expressed in Escherichia coli.Tag : Protein Accession No. : P14210Protein Accession No.URL : https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=3082Amino Acid Sequence : MQRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCETMolecular…
CYR61 (Human) Recombinant Protein
Name : CYR61 (Human) Recombinant ProteinBiological Activity : Human CYR61 (O00622) recombinant protein expressed in Escherichia coli.Tag : Protein Accession No. : O00622Protein Accession No.URL : https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=3491Amino Acid Sequence :…
PRL (Ovine) Recombinant Protein
Name : PRL (Ovine) Recombinant ProteinBiological Activity : Ovine Prl recombinant protein expressed in Escherichia coli.Tag : Protein Accession No. : Protein Accession No.URL : https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=443317Amino Acid Sequence : Molecular…
Gzmb (Mouse) Recombinant Protein
Name : Gzmb (Mouse) Recombinant ProteinBiological Activity : Mouse Gzmb (P04187, 19 a.a. - 247 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression system.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional…
GUSB (Human) Recombinant Protein
Name : GUSB (Human) Recombinant ProteinBiological Activity : Human GUSB (P08236, 23 a.a. - 651 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression system.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional…
FHL2 (Human) Recombinant Protein
Name : FHL2 (Human) Recombinant ProteinBiological Activity : Human FHL2 (NP_001034581, 1 a.a. - 279 a.a ) full-length recombinant protein with His tag expressed in Escherichia coli.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag…
Csf3 (Mouse) Recombinant Protein
Name : Csf3 (Mouse) Recombinant ProteinBiological Activity : Mouse Csf3 (P09920, 31 a.a. - 208 a.a.) partial recombinant protein expressed in CHO cells.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional ProteinsTag : Protein Accession…
Il1b (Rat) Recombinant Protein
Name : Il1b (Rat) Recombinant ProteinBiological Activity : Rat Il1b (Q63264, 117 a.a. - 268 a.a.) partial recombinant protein expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional ProteinsTag : Protein Accession…
FITC-Labeled Human Transferrin Protein 2101
Product Name : FITC-Labeled Human Transferrin Protein 2101express system : HEK293Product tag : C-HisPurity: > 95% as determined by Tris-Bis PAGE;> 95% as determined by HPLCBackground: Transferrin (Tf), an iron…
EGF (Human) Recombinant Protein
Name : EGF (Human) Recombinant ProteinBiological Activity : Human EGF (P01133, 971 a.a. - 1023 a.a.) partial recombinant protein expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional ProteinsTag : Result of…
Cynomolgus TSLP Protein 5153
Product Name : Cynomolgus TSLP Protein 5153express system : HEK293Product tag : C-HisPurity: > 95% as determined by Tris-Bis PAGE;> 95% as determined by HPLCBackground: Thymic Stromal Lymphopoietin (TSLP) was…
SARS-CoV-2 VLPs B1.351 (Beta)
Name : SARS-CoV-2 VLPs B1.351 (Beta)Biological Activity : SARS-CoV-2 virus-like particles B1.351 (Beta) are composed of four structural proteins: Membrane protein (M), Nucleocapsid protein (N), Beta-spike protein (S) and Envelope…
Cynomolgus HGFA Protein (pro form) 2771
Product Name : Cynomolgus HGFA Protein (pro form) 2771express system : HEK293Product tag : C-HisPurity: > 95% as determined by Tris-Bis PAGE;> 95% as determined by HPLCBackground: Hepatocyte growth factor…
SLAMF7 (Human) Recombinant Protein
Name : SLAMF7 (Human) Recombinant ProteinBiological Activity : Human SLAMF7 (NP_067004.3, 23 a.a. - 226 a.a.) partial recombinant protein with Fc, 6x His tag at C-terminal expressed in HEK293 cells.Bioactive…
Candida Antigen Assay Control BC200
Product Name : Candida Antigen Assay Control BC200express system : Product tag : Purity: Background: Molecular Weight: Available Size : 1 mgEndotoxin: Form : liquidStorage Instructions : Storage buffer: Additional…
N (HCoV-NL63) Recombinant Protein
Name : N (HCoV-NL63) Recombinant ProteinBiological Activity : HCoV-NL63 N (130 amino acids) partial recombinant protein expressed in Escherichia coli.Tag : This product contains sodium azide: a POISONOUS AND HAZARDOUS…
Varicella-Zoster Virus Glycoprotein Antigen BA104VSG
Product Name : Varicella-Zoster Virus Glycoprotein Antigen BA104VSGexpress system : Product tag : Purity: Background: Molecular Weight: Available Size : 1 mgEndotoxin: Form : liquidStorage Instructions : Storage buffer: Additional…
SERPINA12 (Human) Recombinant Protein
Name : SERPINA12 (Human) Recombinant ProteinBiological Activity : Human SERPINA12 (Q8IW75) recombinant protein expressed in E. Coli.Tag : Protein Accession No. : Q8IW75Protein Accession No.URL : https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=145264Amino Acid Sequence :…
Rat Coagulation Factor II Protein 5035
Product Name : Rat Coagulation Factor II Protein 5035express system : HEK293Product tag : C-HisPurity: > 95% as determined by Tris-Bis PAGE;> 95% as determined by HPLCBackground: Prothrombin, or coagulation factor…
PSPN (Human) Recombinant Protein
Name : PSPN (Human) Recombinant ProteinBiological Activity : Human PSPN (O60542) recombinant protein expressed in E.Coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional ProteinsTag : Result of activity analysisProtein Accession No. : O60542Protein Accession…
Mouse TLT-1/TREML1 Protein 3140
Product Name : Mouse TLT-1/TREML1 Protein 3140express system : HEK293Product tag : C-hFcPurity: > 95% as determined by Tris-Bis PAGE;> 95% as determined by HPLCBackground: Triggering receptor expressed on myeloid…
CASR (Human) Recombinant Protein (Q02)
Name : CASR (Human) Recombinant Protein (Q02)Biological Activity : Human CASR partial ORF ( NP_000379.2, 21 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal.Tag : Best use within…
MFAP2 (Human) Recombinant Protein
Name : MFAP2 (Human) Recombinant ProteinBiological Activity : Human MFAP2 (NP_002394, 18 a.a. - 183 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.Tag : Protein Accession No.…
Biotinylated Human HLA-E*01:03&B2M&EBV LMP1 (GGDPHLPTL) Monomer Protein 2037
Product Name : Biotinylated Human HLA-E*01:03&B2M&EBV LMP1 (GGDPHLPTL) Monomer Protein 2037express system : HEK293Product tag : C-His-AviPurity: > 95% as determined by Tris-Bis PAGE;> 95% as determined by HPLCBackground: Epstein-Barr…
BST2 (Human) Recombinant Protein (P03)
Name : BST2 (Human) Recombinant Protein (P03)Biological Activity : Human BST2 full-length ORF ( NP_004326.1, 1 a.a. - 180 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
EPHB1 (Human) Recombinant Protein
Name : EphB1 (Human) Recombinant ProteinBiological Activity : Human EphB1 (NP_003148.2, 1 a.a. - 841 a.a.) full-length recombinant protein with GST tag expressed in Baculovirus infected Sf21 cells.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional…
Mouse CDCP1 Protein 4865
Product Name : Mouse CDCP1 Protein 4865express system : HEK293Product tag : C-HisPurity: > 95% as determined by Tris-Bis PAGE;> 95% as determined by HPLCBackground: Tumor metastasis depends on the…
Biotinylated Human PD-1 / PDCD1 Protein, Avitag™,His Tag (recommended for biopanning) (MALS verified)
Name : Biotinylated Human PD-1 / PDCD1 Protein, Avitag™,His Tag (recommended for biopanning) (MALS verified)Background : Programmed cell death protein 1 (PD-1) is also known as CD279 and PDCD1, is…
IL12B (Human) Recombinant Protein
Name : IL12B (Human) Recombinant ProteinBiological Activity : Human IL12B (NP_002178, 23 a.a. - 328 a.a.) partial recombinant protein with His tag expressed in Hi-5 cells.Tag : Protein Accession No.…
Mouse ANXA1 Protein 3742
Product Name : Mouse ANXA1 Protein 3742express system : E.coliProduct tag : C-HisPurity: > 95% as determined by Tris-Bis PAGE;> 95% as determined by HPLCBackground: Atherosclerosis, characterized by the formation…
Human LY75 / CD205 Protein, His Tag
Name : Human LY75 / CD205 Protein, His TagBackground : lymphocyte antigen 75 (Ly 75, also known as CD205, CLEC13B, GP200-MR6 and DEC-205, is a type I transmembrane protein that…
Human TENM2 Protein 2877
Product Name : Human TENM2 Protein 2877express system : HEK293Product tag : N-HisPurity: > 90% as determined by Tris-Bis PAGEBackground: Teneurin-2 is a member of a novel family of transmembrane…
Human CD34 Protein, His Tag
Name : Human CD34 Protein, His TagBackground : CD34 molecule is a cluster of differentiation molecule present on certain cells within the human body. It is a cell surface glycoprotein…
Vegfa (Rat) Recombinant Protein
Name : VEGFa (Rat) Recombinant ProteinBiological Activity : Rat VEGFa recombinant protein expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional ProteinsTag : Result of activity analysisProtein Accession No. : AAL07526.1Protein Accession…
Human LOX1 Protein 3747
Product Name : Human LOX1 Protein 3747express system : HEK293Product tag : N-HisPurity: > 95% as determined by Tris-Bis PAGE;> 95% as determined by HPLCBackground: LOX-1 is a transmembrane glycoprotein…
FITC-Labeled Human CLEC12A / MICL / CLL-1 Protein, His Tag
Name : FITC-Labeled Human CLEC12A / MICL / CLL-1 Protein, His TagBackground : CLEC12A (C-type lectin domain family 12 member A) is also known as CLL1, DCAL2, MICL. Clec12a is…
KIT (T670I) (Human) Recombinant Protein
Name : KIT (T670I) (Human) Recombinant ProteinBiological Activity : Human KIT (NM_000222.2, 544 a.a. - 976 a.a.) T670I mutant with GST-His tag partial protein expressed in Sf9 cells.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional…
Biotinylated Human FGFR3 alpha (IIIb) Protein 4761
Product Name : Biotinylated Human FGFR3 alpha (IIIb) Protein 4761express system : HEK293Product tag : C-His-AviPurity: > 95% as determined by Tris-Bis PAGE;> 95% as determined by HPLCBackground: Four distinct…
Human NKG2D / CD314 Protein, His Tag
Name : Human NKG2D / CD314 Protein, His TagBackground : NKG2D is a transmembrane protein belonging to the CD94/NKG2 family of C-type lectin-like receptors, also known as KLRK1, CD314, D12S2489E,…
Human IFN gamma/IFNG Protein 4773
Product Name : Human IFN gamma/IFNG Protein 4773express system : HEK293Product tag : C-His-AviPurity: > 95% as determined by Tris-Bis PAGE;> 95% as determined by HPLCBackground: Interferon-gamma (IFN gamma) is…
Human Akt1 Protein, His,Strep II Tag
Name : Human Akt1 Protein, His,Strep II TagBackground : RAC-alpha serine/threonine-protein kinase (AKT1) is also known PKB, Protein kinase B alpha, PKB alpha, Proto-oncogene c-Akt and RAC-PK-alpha, which belongs to…
HSPA6 (Human) Recombinant Protein
Name : HSPA6 (Human) Recombinant ProteinBiological Activity : Human HSPA6 (P17066) full-length recombinant protein expressed in yeast.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag : Protein Accession No. : P17066Protein Accession No.URL : https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=3310Amino…
Rat CTLA-4 / CD152 Protein, Fc Tag
Name : Rat CTLA-4 / CD152 Protein, Fc TagBackground : CTLA-4 (Cytotoxic T-Lymphocyte Antigen 4) is also known as CD152 (Cluster of differentiation 152), is a protein receptor that downregulates…
S100A5 (Human) Recombinant Protein
Name : S100A5 (Human) Recombinant ProteinBiological Activity : Human S100A5 (NP_002953, 1 a.a. - 92 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
OR9K2 (Human) Recombinant Protein (P01)
Name : OR9K2 (Human) Recombinant Protein (P01)Biological Activity : Human OR9K2 full-length ORF ( Q8NGE7, 1 a.a. - 313 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
HELT (Human) Recombinant Protein (P01)
Name : HELT (Human) Recombinant Protein (P01)Biological Activity : Human HELT full-length ORF ( AAI60136.1, 1 a.a. - 327 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
EFNB1 (Human) Recombinant Protein (Q01)
Name : EFNB1 (Human) Recombinant Protein (Q01)Biological Activity : Human EFNB1 partial ORF ( AAH52979, 118 a.a. - 217 a.a.) recombinant protein with GST-tag at N-terminal.Tag : Best use within…
LOC285141 (Human) Recombinant Protein (P01)
Name : LOC285141 (Human) Recombinant Protein (P01)Biological Activity : Human LOC285141 full-length ORF ( XP_209489.1, 1 a.a. - 156 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
PTRF (Human) Recombinant Protein (P01)
Name : PTRF (Human) Recombinant Protein (P01)Biological Activity : Human PTRF full-length ORF ( NP_036364.2, 1 a.a. - 390 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
MAP7D2 (Human) Recombinant Protein (P01)
Name : MAP7D2 (Human) Recombinant Protein (P01)Biological Activity : Human MAP7D2 full-length ORF (BAB55093.1, 1 a.a. - 732 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag : Best…
DUT (Human) Recombinant Protein (Q02)
Name : DUT (Human) Recombinant Protein (Q02)Biological Activity : Human DUT partial ORF ( AAH33645.1, 41 a.a. - 122 a.a.) recombinant protein with GST-tag at N-terminal.Tag : Best use within…
C9orf72 (Human) Recombinant Protein (P01)
Name : C9orf72 (Human) Recombinant Protein (P01)Biological Activity : Human C9orf72 full-length ORF (NP_060795.1, 1 a.a. - 481 a.a.) recombinant protein with GST tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
KRTCAP2 (Human) Recombinant Protein (P01)
Name : KRTCAP2 (Human) Recombinant Protein (P01)Biological Activity : Human KRTCAP2 full-length ORF ( NP_776251.1, 1 a.a. - 162 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
BTLA (Human) Recombinant Protein (Q01)
Name : BTLA (Human) Recombinant Protein (Q01)Biological Activity : Human BTLA partial ORF ( NP_861445, 190 a.a. - 289 a.a.) recombinant protein with GST-tag at N-terminal.Tag : Best use within…
SLC25A48 (Human) Recombinant Protein (P01)
Name : SLC25A48 (Human) Recombinant Protein (P01)Biological Activity : Human SLC25A48 full-length ORF ( AAH25747.1, 1 a.a. - 157 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
FBXL14 (Human) Recombinant Protein (P01)
Name : FBXL14 (Human) Recombinant Protein (P01)Biological Activity : Human FBXL14 full-length ORF ( NP_689654.1, 1 a.a. - 418 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
XRRA1 (Human) Recombinant Protein (P01)
Name : XRRA1 (Human) Recombinant Protein (P01)Biological Activity : Human XRRA1 full-length ORF (BAG52364.1, 1 a.a. - 287 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag : Best…
IQCF1 (Human) Recombinant Protein (P01)
Name : IQCF1 (Human) Recombinant Protein (P01)Biological Activity : Human IQCF1 full-length ORF ( NP_689610.1, 1 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
OR1I1 (Human) Recombinant Protein (Q01)
Name : OR1I1 (Human) Recombinant Protein (Q01)Biological Activity : Human OR1I1 partial ORF ( NP_001004713.1, 293 a.a. - 355 a.a.) recombinant protein with GST-tag at N-terminal.Tag : Best use within…
WWOX3 Polyclonal Antibody, FITC
Product Name : WWOX3 Polyclonal Antibody, FITCSpecies Reactivity: Human, Non-human primate, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : FITCForm: LiquidConcentration : 0.5-1.5 mg/mLPurification : Affinity chromatographyStorage buffer: proprietary…
MORN4 (Human) Recombinant Protein (P01)
Name : MORN4 (Human) Recombinant Protein (P01)Biological Activity : Human MORN4 full-length ORF ( NP_849154.1, 1 a.a. - 146 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
Recombinant Human Dysbindin Protein
Product Name : Recombinant Human Dysbindin ProteinTargetID : Q96EV8Source : E.coliGene Accession Number : 84062Peptide Sequence : 1-270aaTag : Purity : >90% as determined by SDS-PAGE.Formulation : Freeze-dried powderStorage Buffer…
WDR92 Monoclonal Antibody (OTI5H5), TrueMAB™
Product Name : WDR92 Monoclonal Antibody (OTI5H5), TrueMAB™Species Reactivity: HumanHost/Isotype : Mouse / IgG2bClass:MonoclonalType : AntibodyClone: OTI5H5Conjugate : UnconjugatedForm: liquidConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS with 1%…
MARCH3 (Human) Recombinant Protein (Q01)
Name : MARCH3 (Human) Recombinant Protein (Q01)Biological Activity : Human MARCH3 partial ORF ( NP_848545, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.Tag : Best use within…
Vobarilizumab Humanized Recombinant Human Monoclonal Antibody
Product Name : Vobarilizumab Humanized Recombinant Human Monoclonal AntibodySpecies Reactivity: HumanHost/Isotype : HumanClass:Recombinant MonoclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Metal-chelate chromatographyStorage buffer: PBS, pH 7.4Contains…
GALNT13 (Human) Recombinant Protein (P01)
Name : GALNT13 (Human) Recombinant Protein (P01)Biological Activity : Human GALNT13 full-length ORF ( NP_443149.1, 1 a.a. - 556 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
Recombinant Carbonic Anhydrase XII (CA12)
Product Name : Recombinant Carbonic Anhydrase XII (CA12)TargetID : O43570Source : E.coliGene Accession Number : 771Peptide Sequence : Ala25~Leu302Tag : N-6HisPurity : > 90%Formulation : Freeze-dried powderStorage Buffer : PBSStorage…
Von Willebrand Factor Polyclonal Antibody
Product Name : Von Willebrand Factor Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS…
DBT (Human) Recombinant Protein (P01)
Name : DBT (Human) Recombinant Protein (P01)Biological Activity : Human DBT full-length ORF (BAG36008.1, 1 a.a. - 482 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag : Best…
Recombinant Goat Interleukin 2 (IL2)
Product Name : Recombinant Goat Interleukin 2 (IL2)TargetID : P36835Source : E.coliGene Accession Number : Peptide Sequence : Ala21-Thr155Tag : N-6HisPurity : > 90%Formulation : Freeze-dried powderStorage Buffer : PBSStorage…
Vaccinia Virus Polyclonal Antibody, FITC
Product Name : Vaccinia Virus Polyclonal Antibody, FITCSpecies Reactivity: VirusHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : FITCForm: LiquidConcentration : 4-5 mg/mLPurification : IgG fractionStorage buffer: PBS, pH 7.2,…
DKFZp434B1231 (Human) Recombinant Protein (P01)
Name : DKFZp434B1231 (Human) Recombinant Protein (P01)Biological Activity : Human DKFZp434B1231 full-length ORF ( NP_840059.1, 1 a.a. - 868 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
Recombinant Human Lipase, Hormone Sensitive (LIPE)
Product Name : Recombinant Human Lipase, Hormone Sensitive (LIPE)TargetID : Q05469Source : E.coliGene Accession Number : 3991Peptide Sequence : Met302-Leu425Tag : N-6HisPurity : > 90%Formulation : Freeze-dried powderStorage Buffer :…
VPS34 (C terminal) Polyclonal Antibody
Product Name : VPS34 (C terminal) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.38 mg/mLPurification : Antigen affinity chromatographyStorage buffer:…
FRMD5 (Human) Recombinant Protein (P01)
Name : FRMD5 (Human) Recombinant Protein (P01)Biological Activity : Human FRMD5 full-length ORF ( NP_116281.2, 1 a.a. - 570 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
Recombinant Human Lck Kinase Protein (GST tag)
Product Name : Recombinant Human Lck Kinase Protein (GST tag)TargetID : P06239Source : Baculovirus-Insect CellsGene Accession Number : 3932Peptide Sequence : Met 1-Pro 509Tag : N-GSTPurity : >90% as determined…
VLK Polyclonal Antibody
Product Name : VLK Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBSContains :…
DAB2 (Human) Recombinant Protein (P02)
Name : DAB2 (Human) Recombinant Protein (P02)Biological Activity : Human DAB2 full-length ORF ( AAH03064.1, 1 a.a. - 770 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
Recombinant Mouse CD80 / B7-1 Protein (Fc tag)
Product Name : Recombinant Mouse CD80 / B7-1 Protein (Fc tag)TargetID : Q00609Source : HEK293 CellsGene Accession Number : 12519Peptide Sequence : Met 1-Lys 245Tag : C-FcPurity : >95% as…
VEGF Receptor 1 Recombinant Rabbit Monoclonal Antibody (40H4)
Product Name : VEGF Receptor 1 Recombinant Rabbit Monoclonal Antibody (40H4)Species Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: 40H4Conjugate : UnconjugatedForm: LiquidConcentration : 0.25 mg/mLPurification : Affinity…
CYP4A11 (Human) Recombinant Protein (P01)
Name : CYP4A11 (Human) Recombinant Protein (P01)Biological Activity : Human CYP4A11 full-length ORF ( AAH22851, 1 a.a. - 215 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
TMEM7 (Human) Recombinant Protein (Q01)
Name : TMEM7 (Human) Recombinant Protein (Q01)Biological Activity : Human TMEM7 partial ORF ( NP_113628, 81 a.a. - 180 a.a.) recombinant protein with GST-tag at N-terminal.Tag : Best use within…
Recombinant Human MMP8 / CLG1 Protein (His tag)
Product Name : Recombinant Human MMP8 / CLG1 Protein (His tag)TargetID : P22894Source : HEK293 CellsGene Accession Number : 4317Peptide Sequence : Met 1-Gly 467Tag : C-HisPurity : >85% as…
VBP1 Monoclonal Antibody (UMAB75), UltraMAB™
Product Name : VBP1 Monoclonal Antibody (UMAB75), UltraMAB™Species Reactivity: HumanHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: UMAB75Conjugate : UnconjugatedForm: liquidConcentration : 0.5-1.0 mg/mLPurification : Affinity chromatographyStorage buffer: PBS with 1%…
SLC25A31 (Human) Recombinant Protein (P01)
Name : SLC25A31 (Human) Recombinant Protein (P01)Biological Activity : Human SLC25A31 full-length ORF ( NP_112581.1, 1 a.a. - 315 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
Recombinant Mouse STHM / ST6GALNAC2 Protein (His tag)
Product Name : Recombinant Mouse STHM / ST6GALNAC2 Protein (His tag)TargetID : P70277Source : HEK293 CellsGene Accession Number : 20446Peptide Sequence : Ser 28-Arg 373Tag : C-HisPurity : >95% as…
VANGL1 Monoclonal Antibody (CL0241)
Product Name : VANGL1 Monoclonal Antibody (CL0241)Species Reactivity: HumanHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: CL0241Conjugate : UnconjugatedForm: LiquidConcentration : 0.7 mg/mLPurification : Protein AStorage buffer: PBS, pH 7.2, with…
CD276 (Human) Recombinant Protein
Name : CD276 (Human) Recombinant ProteinBiological Activity : Purified CD276 (AAH62581.1 237 a.a. - 461 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.Recombinant Human Protein,Recombinant…
Recombinant Mouse PGLYRP1 / PGRP-S Protein (His tag)
Product Name : Recombinant Mouse PGLYRP1 / PGRP-S Protein (His tag)TargetID : O88593Source : HEK293 CellsGene Accession Number : 21946Peptide Sequence : Met 1-Glu 182Tag : C-HisPurity : >95% as…
Recombinant Mouse FCRL1 Protein (His Tag)
Product Name : Recombinant Mouse FCRL1 Protein (His Tag)TargetID : Q8R4Y0Source : HEK293 CellsGene Accession Number : 229499Peptide Sequence : Met1-Thr204Tag : C-HisPurity : >95% as determined by SDS-PAGE.Formulation :…
V5 Tag Monoclonal Antibody (E10/V4RR), HRP
Product Name : V5 Tag Monoclonal Antibody (E10/V4RR), HRPSpecies Reactivity: TagHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: E10/V4RRConjugate : HRP View additional formats Biotin DyLight 488 DyLight 650 DyLight 680…
Recombinant Human ALDH3A1 Protein (His Tag)
Product Name : Recombinant Human ALDH3A1 Protein (His Tag)TargetID : P30838Source : Baculovirus-Insect CellsGene Accession Number : 218Peptide Sequence : Met 1-His 453Tag : N-HisPurity : >90% as determined by…
USP7 Monoclonal Antibody (5F11)
Product Name : USP7 Monoclonal Antibody (5F11)Species Reactivity: HumanHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: 5F11Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Storage buffer: ascitesContains : 0.03% sodium azideStorage…
Recombinant Human E-Selectin / CD62e / SELE Protein (His tag)
Product Name : Recombinant Human E-Selectin / CD62e / SELE Protein (His tag)TargetID : P16581Source : HEK293 CellsGene Accession Number : 6401Peptide Sequence : Met 1-Pro 556Tag : C-HisPurity :…
UNC45A Polyclonal Antibody
Product Name : UNC45A Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.17 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH…
Recombinant Chloride Intracellular Channel Protein 1 (CLIC1)
Product Name : Recombinant Chloride Intracellular Channel Protein 1 (CLIC1)TargetID : O00299Source : E.coliGene Accession Number : 1192Peptide Sequence : Lys79~Lys241Tag : N-6HisPurity : >95% as determined by SDS-PAGE.Formulation :…
Recombinant Human 14-3-3 tau / 14-3-3 theta / YWHAQ Protein (GST tag)
Product Name : Recombinant Human 14-3-3 tau / 14-3-3 theta / YWHAQ Protein (GST tag)TargetID : P27348Source : E.coliGene Accession Number : 10971Peptide Sequence : Met 1-Asn 245Tag : N-GSTPurity…
UFD1L Monoclonal Antibody (OTI7C9)
Product Name : UFD1L Monoclonal Antibody (OTI7C9)Species Reactivity: HumanHost/Isotype : Mouse / IgG2bClass:MonoclonalType : AntibodyClone: OTI7C9Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Affinity ChromatographyStorage buffer: PBS, pH 7.3, with…
Recombinant Farnesyl Diphosphate Synthase (FDPS)
Product Name : Recombinant Farnesyl Diphosphate Synthase (FDPS)TargetID : P14324Source : E.coliGene Accession Number : 2224Peptide Sequence : Met1~Lys419Tag : N-terminal His and GST TagPurity : >90% as determined by…
Recombinant Mouse PARP-1 / PARP Protein (His tag)
Product Name : Recombinant Mouse PARP-1 / PARP Protein (His tag)TargetID : P11103Source : Baculovirus-Insect CellsGene Accession Number : Peptide Sequence : Met 1-Trp 1014Tag : N-HisPurity : >90% as…
Tryptase Monoclonal Antibody (C13)
Product Name : Tryptase Monoclonal Antibody (C13)Species Reactivity: Dog, PigHost/Isotype : Mouse / IgG2b, kappaClass:MonoclonalType : AntibodyClone: C13Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein A/GStorage buffer: PBS, pH…
Recombinant Human LILRA5/CD85 Protein (Fc Tag)
Product Name : Recombinant Human LILRA5/CD85 Protein (Fc Tag)TargetID : A6NI73Source : HEK293 CellsGene Accession Number : 353514Peptide Sequence : Met 1-Arg268Tag : C-FcPurity : >85% as determined by SDS-PAGE.Formulation…
U2AF59 Polyclonal Antibody
Product Name : U2AF59 Polyclonal AntibodySpecies Reactivity: YeastHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.5-1.5 mg/mLPurification : Affinity chromatographyStorage buffer: proprietary buffer, pH 7.4-7.8, with…
Recombinant Mouse CD34 Protein (His tag)
Product Name : Recombinant Mouse CD34 Protein (His tag)TargetID : Q64314Source : HEK293 CellsGene Accession Number : 12490Peptide Sequence : Met 1-Thr 287Tag : C-HisPurity : >85% as determined by…
Tryptase Monoclonal Antibody (C10)
Product Name : Tryptase Monoclonal Antibody (C10)Species Reactivity: HumanHost/Isotype : Mouse / IgGClass:MonoclonalType : AntibodyClone: C10Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein A/GStorage buffer: PBS with 50% glycerolContains…
Recombinant Human CD68 Protein
Product Name : Recombinant Human CD68 ProteinTargetID : P34810Source : E.coliGene Accession Number : 968Peptide Sequence : 22-319aaTag : N-6HisPurity : >90% as determined by SDS-PAGE.Formulation : Freeze-dried powderStorage Buffer…
Transferrin (Early Marker of Oligodendrocytes) Monoclonal Antibody (TF/4795)
Product Name : Transferrin (Early Marker of Oligodendrocytes) Monoclonal Antibody (TF/4795)Species Reactivity: HumanHost/Isotype : Mouse / IgG2, kappaClass:MonoclonalType : AntibodyClone: TF/4795Conjugate : UnconjugatedForm: LiquidConcentration : 200 µg/mLPurification : Protein A/GStorage…
Recombinant Human Resistin Protein (Fc Tag)
Product Name : Recombinant Human Resistin Protein (Fc Tag)TargetID : Q9HD89Source : HEK293 CellsGene Accession Number : 56729Peptide Sequence : Ser17-Pro108Tag : C-FcPurity : >90% as determined by SDS-PAGE.Formulation :…
Recombinant Human CD300C Protein
Product Name : Recombinant Human CD300C ProteinTargetID : Q08708Source : Baculovirus-Insect CellsGene Accession Number : 10871Peptide Sequence : 29-183aaTag : Purity : >90% as determined by SDS-PAGE.Formulation : Freeze-dried powderStorage…
Recombinant Human Cystatin C/CST3 Protein(C-6His)
Product Name : Recombinant Human Cystatin C/CST3 Protein(C-6His)TargetID : P01034Source : HEK293 CellsGene Accession Number : 1471Peptide Sequence : Ser27-Ala146Tag : C-6HisPurity : >95% as determined by SDS-PAGE.Formulation : Freeze-dried…
TTLL11 Polyclonal Antibody
Product Name : TTLL11 Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.5 mg/mLPurification : Affinity ChromatographyStorage buffer: PBS with 2% sucroseContains :…
Recombinant Human IL17 / IL17A Protein
Product Name : Recombinant Human IL17 / IL17A ProteinTargetID : Q16552Source : E.coliGene Accession Number : 3605Peptide Sequence : Ile20-Ala155Tag : Purity : >95% as determined by SDS-PAGE.Formulation : Freeze-dried…
TTC21A Polyclonal Antibody
Product Name : TTC21A Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.2 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH 7.2, with…
Recombinant Mouse Thymic Stromal Lymphopoietin Receptor/TSP R Protein(C-6His)
Product Name : Recombinant Mouse Thymic Stromal Lymphopoietin Receptor/TSP R Protein(C-6His)TargetID : Q9JIE6Source : HEK293 CellsGene Accession Number : 53603Peptide Sequence : Ala20-Leu233Tag : C-6HisPurity : >95% as determined by…
TRPV1 Monoclonal Antibody (1A3C9)
Product Name : TRPV1 Monoclonal Antibody (1A3C9)Species Reactivity: HumanHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: 1A3C9Conjugate : UnconjugatedForm: LiquidConcentration : 1000 µg/mLPurification : Protein AStorage buffer: PBS, pH 7.3, with…
TSC22D2 Monoclonal Antibody (6G10)
Product Name : TSC22D2 Monoclonal Antibody (6G10)Species Reactivity: HumanHost/Isotype : Mouse / IgM, kappaClass:MonoclonalType : AntibodyClone: 6G10Conjugate : UnconjugatedForm: LiquidConcentration : See LabelPurification : Storage buffer: ascitesContains : no preservativeStorage…
C11orf63 (Human) Recombinant Protein (P01)
Name : C11orf63 (Human) Recombinant Protein (P01)Biological Activity : Human C11orf63 full-length ORF ( NP_954575.1, 1 a.a. - 307 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
TRPC4 (extracellular) Polyclonal Antibody
Product Name : TRPC4 (extracellular) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LyophilizedConcentration : 0.85 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS,…
PIP4K2C (Human) Recombinant Protein (Q01)
Name : PIP4K2C (Human) Recombinant Protein (Q01)Biological Activity : Human PIP4K2C partial ORF ( NP_079055.2, 310 a.a. - 381 a.a.) recombinant protein with GST-tag at N-terminal.Tag : Best use within…
TRIM64 Polyclonal Antibody
Product Name : TRIM64 Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.5Purification : Protein A, Antigen affinity chromatographyStorage buffer: PBS, pH 7.4Contains…
TCTN1 (Human) Recombinant Protein (P01)
Name : TCTN1 (Human) Recombinant Protein (P01)Biological Activity : Human TCTN1 full-length ORF (BAB71036.1, 1 a.a. - 573 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag : Best…
TRIM32 Polyclonal Antibody
Product Name : TRIM32 Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.3 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH…
TRCG1 Polyclonal Antibody
Product Name : TRCG1 Polyclonal AntibodySpecies Reactivity: MouseHost/Isotype : Rabbit / IgClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LyophilizedConcentration : Conc. Not DeterminedPurification : Storage buffer: whole serumContains : no preservativeStorage…
CHID1 (Human) Recombinant Protein (P01)
Name : CHID1 (Human) Recombinant Protein (P01)Biological Activity : Human CHID1 full-length ORF ( AAH95409.1, 1 a.a. - 393 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
TRA16 Polyclonal Antibody
Product Name : TRA16 Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS with 1%…
SEMA4A (Human) Recombinant Protein (P01)
Name : SEMA4A (Human) Recombinant Protein (P01)Biological Activity : Human SEMA4A full-length ORF ( NP_071762.2, 1 a.a. - 761 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
SRR (Human) Recombinant Protein (Q01)
Name : SRR (Human) Recombinant Protein (Q01)Biological Activity : Human SRR partial ORF ( NP_068766.1, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.Tag : Best use within…
TNNT2 Monoclonal Antibody (OTI7A1), TrueMAB™
Product Name : TNNT2 Monoclonal Antibody (OTI7A1), TrueMAB™Species Reactivity: HumanHost/Isotype : Mouse / IgG2aClass:MonoclonalType : AntibodyClone: OTI7A1Conjugate : UnconjugatedForm: lyophilizedConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH 7.3,…
RDH14 (Human) Recombinant Protein (P01)
Name : RDH14 (Human) Recombinant Protein (P01)Biological Activity : Human RDH14 full-length ORF ( NP_065956.1, 1 a.a. - 336 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
Ret any inconvenience that our customers may incur as a result.
Ret any inconvenience that our customers may incur as a result. Please check our web site for up-to-date information about supplies and for the name and contact information of the…
TNFSF8 Monoclonal Antibody (4E6)
Product Name : TNFSF8 Monoclonal Antibody (4E6)Species Reactivity: HumanHost/Isotype : Mouse / IgG1, kappaClass:MonoclonalType : AntibodyClone: 4E6Conjugate : UnconjugatedForm: LiquidConcentration : See LabelPurification : Affinity chromatographyStorage buffer: PBS, pH 7.4Contains…
SYT13 (Human) Recombinant Protein (P01)
Name : SYT13 (Human) Recombinant Protein (P01)Biological Activity : Human SYT13 full-length ORF (BAF83698.1, 1 a.a. - 426 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag : Best…
On the oligonucleotide during cleavage and deprotection steps. It should be
On the oligonucleotide during cleavage and deprotection steps. It should be removed in aqueous acid after removal of the ammonia. The MMT group can, of course, also be used in…
TNFRSF11A Monoclonal Antibody (2G2)
Product Name : TNFRSF11A Monoclonal Antibody (2G2)Species Reactivity: Human, Mouse, RatHost/Isotype : Mouse / IgG1, kappaClass:MonoclonalType : AntibodyClone: 2G2Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: PBS, pH…
MAN1C1 (Human) Recombinant Protein (Q01)
Name : MAN1C1 (Human) Recombinant Protein (Q01)Biological Activity : Human MAN1C1 partial ORF ( NP_065112.1, 463 a.a. - 565 a.a.) recombinant protein with GST-tag at N-terminal.Tag : Best use within…
30X, 72 (5 min). Reaction conditions: 1X PCR buffer (20 mM Tris (pH 8.4), 50 mM
30X, 72 (5 min). Reaction conditions: 1X PCR buffer (20 mM Tris (pH 8.4), 50 mM KCl, 1.5 mM MgCl2), Primers (0.5 ), polydT primer (1 ), 0.16 mM dNTPs,…
TNF alpha Monoclonal Antibody (TN3-19.12), Functional Grade, eBioscience™
Product Name : TNF alpha Monoclonal Antibody (TN3-19.12), Functional Grade, eBioscience™Species Reactivity: Mouse, RatHost/Isotype : Armenian hamster / IgGClass:MonoclonalType : AntibodyClone: TN3-19.12Conjugate : Functional Grade View additional formats Biotin eFluor…
DPYSL5 (Human) Recombinant Protein (P01)
Name : DPYSL5 (Human) Recombinant Protein (P01)Biological Activity : Human DPYSL5 full-length ORF ( AAH02874, 1 a.a. - 564 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
TMIGD2 Monoclonal Antibody (8A1)
Product Name : TMIGD2 Monoclonal Antibody (8A1)Species Reactivity: HumanHost/Isotype : Mouse / IgG1, kappaClass:MonoclonalType : AntibodyClone: 8A1Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS with 50%…
TMEM173/STING Polyclonal Antibody
Product Name : TMEM173/STING Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.33 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH…
TLR6 Monoclonal Antibody (86B1153.2)
Product Name : TLR6 Monoclonal Antibody (86B1153.2)Species Reactivity: HumanHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: 86B1153.2Conjugate : Unconjugated View additional formats PEForm: LiquidConcentration : 1.0 mg/mLPurification : Protein GStorage buffer:…
TLR2 Monoclonal Antibody (2G9)
Product Name : TLR2 Monoclonal Antibody (2G9)Species Reactivity: HumanHost/Isotype : Mouse / IgG2a, kappaClass:MonoclonalType : AntibodyClone: 2G9Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: PBS, pH 7.4Contains :…
Pamvatamig Biosimilar
Product Name : Pamvatamig BiosimilarHost species : Homo sapiensSpecies reactivity : HumanForm: LiquidStorage buffer : 0.01M PBS, pH 7.4.Concentration: 1 mg/mlPurity : >95% by SDS-PAGE.Clonality: MonoclonalApplications : Research Grade BiosimilarTarget…
TIMP-1 Polyclonal Antibody, Cyanine3
Product Name : TIMP-1 Polyclonal Antibody, Cyanine3Species Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : Cyanine3Form: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: TBS with…
THAP8 Polyclonal Antibody
Product Name : THAP8 Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.05 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH 7.2, with…
TGM2 Monoclonal Antibody (2F4)
Product Name : TGM2 Monoclonal Antibody (2F4)Species Reactivity: HumanHost/Isotype : Mouse / IgG2a, kappaClass:MonoclonalType : AntibodyClone: 2F4Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: PBS, pH 7.4Contains :…
TG Monoclonal Antibody (OTI1G4), TrueMAB™
Product Name : TG Monoclonal Antibody (OTI1G4), TrueMAB™Species Reactivity: HumanHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: OTI1G4Conjugate : UnconjugatedForm: liquidConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS with 1%…
CFC1 (Human) Recombinant Protein (Q01)
Name : CFC1 (Human) Recombinant Protein (Q01)Biological Activity : Human CFC1 partial ORF ( NP_115934.1, 27 a.a. - 93 a.a.) recombinant protein with GST-tag at N-terminal.Tag : Best use within…
integrin beta 1 binding protein 1
Product Name : integrin beta 1 binding protein 1Target gene : ITGB1BP1verified_species_reactivity : Humaninterspecies_information : 95%, ENSMUSG00000062352, species_id: MOUSE, 95%, ENSRNOG00000059402, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer :…
TFCP2 Polyclonal Antibody
Product Name : TFCP2 Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.27 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH…
insulin receptor-related receptor
Product Name : insulin receptor-related receptorTarget gene : INSRRverified_species_reactivity : Humaninterspecies_information : 94%, ENSMUSG00000005640, species_id: MOUSE, 94%, ENSRNOG00000057702, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and…
IK cytokine, down-regulator of HLA II
Product Name : IK cytokine, down-regulator of HLA IITarget gene : IKverified_species_reactivity : Humaninterspecies_information : 99%, ENSMUSG00000024474, species_id: MOUSE, 100%, ENSRNOG00000017251, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer :…
TCR alpha/beta Monoclonal Antibody (WT31), PE, eBioscience™
Product Name : TCR alpha/beta Monoclonal Antibody (WT31), PE, eBioscience™Species Reactivity: HumanHost/Isotype : Mouse / IgG1, kappaClass:MonoclonalType : AntibodyClone: WT31Conjugate : PE View additional formats FITCForm: LiquidConcentration : 5 µL/TestPurification…
COL10A1 (Human) Recombinant Protein (P01)
Name : COL10A1 (Human) Recombinant Protein (P01)Biological Activity : Human COL10A1 full-length ORF (ADR83096.1, 1 a.a. - 680 a.a.) recombinant protein with GST tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
huntingtin
Product Name : huntingtinTarget gene : HTTverified_species_reactivity : Humaninterspecies_information : 82%, ENSMUSG00000029104, species_id: MOUSE, 85%, ENSRNOG00000011073, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and PBS (pH…
TCL1B Polyclonal Antibody
Product Name : TCL1B Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Goat / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LyophilizedConcentration : 0.2 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS with 5% trehaloseContains…
CNN2 (Human) Recombinant Protein (Q01)
Name : CNN2 (Human) Recombinant Protein (Q01)Biological Activity : Human CNN2 partial ORF ( NP_004359.1, 193 a.a. - 290 a.a.) recombinant protein with GST-tag at N-terminal.Tag : Best use within…
homeobox A11
Product Name : homeobox A11Target gene : HOXA11verified_species_reactivity : Humaninterspecies_information : 100%, ENSMUSG00000038210, species_id: MOUSE, 100%, ENSRNOG00000061531, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and PBS…
MTMR12 (Human) Recombinant Protein (Q01)
Name : MTMR12 (Human) Recombinant Protein (Q01)Biological Activity : Human MTMR12 partial ORF ( NP_061934, 648 a.a. - 747 a.a.) recombinant protein with GST-tag at N-terminal.Tag : Best use within…
hematological and neurological expressed 1
Product Name : hematological and neurological expressed 1Target gene : HN1verified_species_reactivity : Humaninterspecies_information : 95%, ENSMUSG00000020737, species_id: MOUSE, 97%, ENSRNOG00000003661, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40%…
Syntrophin alpha-1 Monoclonal Antibody (OTI1H10)
Product Name : Syntrophin alpha-1 Monoclonal Antibody (OTI1H10)Species Reactivity: Dog, Human, Non-human primate, RatHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: OTI1H10Conjugate : UnconjugatedForm: LiquidConcentration : 0.76 mg/mLPurification : Affinity ChromatographyStorage…
CCDC76 (Human) Recombinant Protein (P01)
Name : CCDC76 (Human) Recombinant Protein (P01)Biological Activity : Human CCDC76 full-length ORF ( NP_061956.1, 1 a.a. - 481 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
HECT domain containing E3 ubiquitin protein ligase 4
Product Name : HECT domain containing E3 ubiquitin protein ligase 4Target gene : HECTD4verified_species_reactivity : Humaninterspecies_information : 98%, ENSMUSG00000042744, species_id: MOUSE, 97%, ENSRNOG00000001352, species_id: RATclonality : Polyclonalisotype : IgGhost :…
Sulfotransferase family 1E, estrogen-preferring, member 1 Monoclonal Antibody (CPTC-SULT1E1-1)
Product Name : Sulfotransferase family 1E, estrogen-preferring, member 1 Monoclonal Antibody (CPTC-SULT1E1-1)Species Reactivity: HumanHost/Isotype : Mouse / IgG2b, kappaClass:MonoclonalType : AntibodyClone: CPTC-SULT1E1-1Conjugate : UnconjugatedForm: LiquidConcentration : 200 µg/mLPurification : Protein…
GUF1 homolog, GTPase
Product Name : GUF1 homolog, GTPaseTarget gene : GUF1verified_species_reactivity : Humaninterspecies_information : 89%, ENSMUSG00000029208, species_id: MOUSE, 89%, ENSRNOG00000002207, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and…
Somatostatin receptor type 2 (SS2R)/SSTR2 Monoclonal Antibody (SSTR2/7532)
Product Name : Somatostatin receptor type 2 (SS2R)/SSTR2 Monoclonal Antibody (SSTR2/7532)Species Reactivity: HumanHost/Isotype : Mouse / IgG2b, lambdaClass:MonoclonalType : AntibodyClone: SSTR2/7532Conjugate : UnconjugatedForm: LiquidConcentration : 200 µg/mLPurification : Protein A/GStorage…
G-rich RNA sequence binding factor 1
Product Name : G-rich RNA sequence binding factor 1Target gene : GRSF1verified_species_reactivity : Humaninterspecies_information : 89%, ENSMUSG00000044221, species_id: MOUSE, 88%, ENSRNOG00000003392, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer :…
Sir2.1 Polyclonal Antibody
Product Name : Sir2.1 Polyclonal AntibodySpecies Reactivity: C. elegansHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : Conc. Not DeterminedPurification : Storage buffer: whole serumContains : 0.05%…
golgi SNAP receptor complex member 1
Product Name : golgi SNAP receptor complex member 1Target gene : GOSR1verified_species_reactivity : Humaninterspecies_information : 99%, ENSMUSG00000010392, species_id: MOUSE, 99%, ENSRNOG00000003971, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer :…
Septin-8 Recombinant Rabbit Monoclonal Antibody (JE64-99)
Product Name : Septin-8 Recombinant Rabbit Monoclonal Antibody (JE64-99)Species Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: JE64-99Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage…
gastric intrinsic factor (vitamin B synthesis)
Product Name : gastric intrinsic factor (vitamin B synthesis)Target gene : GIFverified_species_reactivity : Humaninterspecies_information : 80%, ENSMUSG00000024682, species_id: MOUSE, 78%, ENSRNOG00000021001, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer :…
guanylate binding protein 7
Product Name : guanylate binding protein 7Target gene : GBP7verified_species_reactivity : Humaninterspecies_information : 54%, ENSMUSG00000028268, species_id: MOUSE, 54%, ENSRNOG00000028768, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
SULT2A1 Recombinant Rabbit Monoclonal Antibody (JG36-18)
Product Name : SULT2A1 Recombinant Rabbit Monoclonal Antibody (JG36-18)Species Reactivity: HumanHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: JG36-18Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: TBS,…
STRC Polyclonal Antibody
Product Name : STRC Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.2 mg/mLPurification : Anitgen affinity chromatographyStorage buffer: PBS, pH 7.2, with…
forkhead box N2
Product Name : forkhead box N2Target gene : FOXN2verified_species_reactivity : Humaninterspecies_information : 80%, ENSMUSG00000034998, species_id: MOUSE, 84%, ENSRNOG00000040110, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and…
STIP1 Polyclonal Antibody
Product Name : STIP1 Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.13 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH…
FCH domain only 1
Product Name : FCH domain only 1Target gene : FCHO1verified_species_reactivity : Humaninterspecies_information : 86%, ENSMUSG00000070000, species_id: MOUSE, 85%, ENSRNOG00000033912, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
ST2 (IL1RL1) Monoclonal Antibody (OTI17D12), TrueMAB™
Product Name : ST2 (IL1RL1) Monoclonal Antibody (OTI17D12), TrueMAB™Species Reactivity: HumanHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: OTI17D12Conjugate : UnconjugatedForm: LyophilizedConcentration : See LabelPurification : Protein A/GStorage buffer: PBS, pH…
Fc fragment of IgG, low affinity IIIa, receptor (CD16a)
Product Name : Fc fragment of IgG, low affinity IIIa, receptor (CD16a)Target gene : FCGR3Averified_species_reactivity : Humaninterspecies_information : 43%, ENSMUSG00000059089, species_id: MOUSE, 43%, ENSRNOG00000024382, species_id: RATclonality : Polyclonalisotype : IgGhost…
family with sequence similarity 228, member B
Product Name : family with sequence similarity 228, member BTarget gene : FAM228Bverified_species_reactivity : Humaninterspecies_information : 27%, ENSMUSG00000024073, species_id: MOUSE, 28%, ENSRNOG00000015249, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer…
SRSF4 Polyclonal Antibody
Product Name : SRSF4 Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH…
family with sequence similarity 160, member A2
Product Name : family with sequence similarity 160, member A2Target gene : FAM160A2verified_species_reactivity : Humaninterspecies_information : 97%, ENSMUSG00000044465, species_id: MOUSE, 97%, ENSRNOG00000017408, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer…
exostosin glycosyltransferase 1
Product Name : exostosin glycosyltransferase 1Target gene : EXT1verified_species_reactivity : Humaninterspecies_information : 99%, ENSMUSG00000061731, species_id: MOUSE, 99%, ENSRNOG00000024886, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and…
SPRY1 Monoclonal Antibody (3H4)
Product Name : SPRY1 Monoclonal Antibody (3H4)Species Reactivity: HumanHost/Isotype : Mouse / IgG2a, kappaClass:MonoclonalType : AntibodyClone: 3H4Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: PBS, pH 7.4Contains :…
ectonucleoside triphosphate diphosphohydrolase 6 (putative)
Product Name : ectonucleoside triphosphate diphosphohydrolase 6 (putative)Target gene : ENTPD6verified_species_reactivity : Humaninterspecies_information : 83%, ENSMUSG00000033068, species_id: MOUSE, 82%, ENSRNOG00000007427, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40%…
Etrolizumab Biosimilar
Product Name : Etrolizumab BiosimilarHost species : HumanizedSpecies reactivity : HumanForm: LiquidStorage buffer : 0.01M PBS, pH 7.4.Concentration: 1 mg/mlPurity : >95% by SDS-PAGE.Clonality: MonoclonalApplications : Research Grade BiosimilarTarget :…
eukaryotic translation initiation factor 4 gamma, 3
Product Name : eukaryotic translation initiation factor 4 gamma, 3Target gene : EIF4G3verified_species_reactivity : Humaninterspecies_information : 81%, ENSMUSG00000028760, species_id: MOUSE, 78%, ENSRNOG00000014368, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer…
SPAG4 Monoclonal Antibody (OTI3E9)
Product Name : SPAG4 Monoclonal Antibody (OTI3E9)Species Reactivity: HumanHost/Isotype : Mouse / IgG2aClass:MonoclonalType : AntibodyClone: OTI3E9Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Affinity ChromatographyStorage buffer: PBS, pH 7.3, with…
enoyl CoA hydratase domain containing 1
Product Name : enoyl CoA hydratase domain containing 1Target gene : ECHDC1verified_species_reactivity : Humaninterspecies_information : 74%, ENSMUSG00000019883, species_id: MOUSE, 71%, ENSRNOG00000011622, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer :…
SOD2 Monoclonal Antibody (3A6C2), CoraLite® 555
Product Name : SOD2 Monoclonal Antibody (3A6C2), CoraLite® 555Species Reactivity: Human, Mouse, Pig, RatHost/Isotype : Mouse / IgG2aClass:MonoclonalType : AntibodyClone: 3A6C2Conjugate : CoraLite® 555 View additional formats CoraLite 594 CoraLite…
dyslexia susceptibility 1 candidate 1
Product Name : dyslexia susceptibility 1 candidate 1Target gene : DYX1C1verified_species_reactivity : Humaninterspecies_information : 84%, ENSMUSG00000089865, species_id: MOUSE, 87%, ENSRNOG00000056654, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40%…
SNX8 Monoclonal Antibody (OTI1E5), TrueMAB™
Product Name : SNX8 Monoclonal Antibody (OTI1E5), TrueMAB™Species Reactivity: HumanHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: OTI1E5Conjugate : UnconjugatedForm: liquidConcentration : 0.81 mg/mLPurification : Affinity chromatographyStorage buffer: PBS with 1%…
Transcription factor binding to ighm enhancer 3
Product Name : Transcription factor binding to ighm enhancer 3Target gene : TFE3verified_species_reactivity : Humaninterspecies_information : 92%, ENSRNOG00000009605, species_id: RAT, 93%, ENSMUSG00000000134, species_id: MOUSEclonality : Monoclonalisotype : IgG2bhost : Mousebuffer…
SNF1 Polyclonal Antibody
Product Name : SNF1 Polyclonal AntibodySpecies Reactivity: YeastHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 3.91 mg/mLPurification : Protein GStorage buffer: PBS, pH 7.4, with 50%…
DnaJ (Hsp40) homolog, subfamily C, member 1
Product Name : DnaJ (Hsp40) homolog, subfamily C, member 1Target gene : DNAJC1verified_species_reactivity : Humaninterspecies_information : 77%, ENSMUSG00000026740, species_id: MOUSE, 75%, ENSRNOG00000000150, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer…
SMOC1 Polyclonal Antibody
Product Name : SMOC1 Polyclonal AntibodySpecies Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1.0 mg/mLPurification : Protein GStorage buffer: PBS, pH 7.4, with…
UFM1 (Human) Recombinant Protein (P01)
Name : UFM1 (Human) Recombinant Protein (P01)Biological Activity : Human UFM1 full-length ORF ( NP_057701.1, 1 a.a. - 85 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLengthTag :…
DEP domain containing MTOR-interacting protein
Product Name : DEP domain containing MTOR-interacting proteinTarget gene : DEPTORverified_species_reactivity : Humaninterspecies_information : 100%, ENSMUSG00000022419, species_id: MOUSE, 100%, ENSRNOG00000004328, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40%…
SMARCAD1/ETL1 Polyclonal Antibody
Product Name : SMARCAD1/ETL1 Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: liquidConcentration : 0.20 mg/mLPurification : Antigen affinity chromatographyStorage buffer: TBS, pH 7.0 to…
DEAD/H (Asp-Glu-Ala-Asp/His) box helicase 11
Product Name : DEAD/H (Asp-Glu-Ala-Asp/His) box helicase 11Target gene : DDX11verified_species_reactivity : Humaninterspecies_information : 64%, ENSMUSG00000035842, species_id: MOUSE, 31%, ENSRNOG00000023803, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40%…
SMAD1 Monoclonal Antibody (3G4)
Product Name : SMAD1 Monoclonal Antibody (3G4)Species Reactivity: HumanHost/Isotype : Mouse / IgG2a, kappaClass:MonoclonalType : AntibodyClone: 3G4Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: PBS, pH 7.4Contains :…
C-X3-C motif chemokine receptor 1
Product Name : C-X3-C motif chemokine receptor 1Target gene : CX3CR1verified_species_reactivity : Humaninterspecies_information : 67%, ENSMUSG00000052336, species_id: MOUSE, 65%, ENSRNOG00000018509, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40%…
SLC7A14 Polyclonal Antibody
Product Name : SLC7A14 Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS with 2% sucroseContains :…
chondroitin sulfate proteoglycan 5 (neuroglycan C)
Product Name : chondroitin sulfate proteoglycan 5 (neuroglycan C)Target gene : CSPG5verified_species_reactivity : Humaninterspecies_information : 77%, ENSMUSG00000032482, species_id: MOUSE, 82%, ENSRNOG00000020833, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer :…
SLC28A3 Polyclonal Antibody
Product Name : SLC28A3 Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.2 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH 7.2, with…
cellular repressor of E1A-stimulated genes 1
Product Name : cellular repressor of E1A-stimulated genes 1Target gene : CREG1verified_species_reactivity : Humaninterspecies_information : 78%, ENSMUSG00000040713, species_id: MOUSE, 76%, ENSRNOG00000003291, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer :…
SIAH1 Polyclonal Antibody
Product Name : SIAH1 Polyclonal AntibodySpecies Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.2 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH 7.3,…
coatomer protein complex, subunit epsilon
Product Name : coatomer protein complex, subunit epsilonTarget gene : COPEverified_species_reactivity : Humaninterspecies_information : 96%, ENSMUSG00000055681, species_id: MOUSE, 95%, ENSRNOG00000020178, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40%…
SH2D4A Monoclonal Antibody (3G8)
Product Name : SH2D4A Monoclonal Antibody (3G8)Species Reactivity: HumanHost/Isotype : Mouse / IgG2a, kappaClass:MonoclonalType : AntibodyClone: 3G8Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: PBS, pH 7.4Contains :…
centrobin, centrosomal BRCA2 interacting protein
Product Name : centrobin, centrosomal BRCA2 interacting proteinTarget gene : CNTROBverified_species_reactivity : Humaninterspecies_information : 77%, ENSMUSG00000032782, species_id: MOUSE, 84%, ENSRNOG00000008270, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40%…
SFRS9 Monoclonal Antibody (1G7)
Product Name : SFRS9 Monoclonal Antibody (1G7)Species Reactivity: Human, MouseHost/Isotype : Mouse / IgG2a, kappaClass:MonoclonalType : AntibodyClone: 1G7Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: PBS, pH 7.4Contains…
chloride channel, nucleotide-sensitive, 1A
Product Name : chloride channel, nucleotide-sensitive, 1ATarget gene : CLNS1Averified_species_reactivity : Humaninterspecies_information : 96%, ENSMUSG00000025439, species_id: MOUSE, 96%, ENSRNOG00000012788, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
SF3B4 Monoclonal Antibody (3A1)
Product Name : SF3B4 Monoclonal Antibody (3A1)Species Reactivity: Human, Mouse, RatHost/Isotype : Mouse / IgG2bClass:MonoclonalType : AntibodyClone: 3A1Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein GStorage buffer: PBS with…
checkpoint kinase 1
Product Name : checkpoint kinase 1Target gene : CHEK1verified_species_reactivity : Humaninterspecies_information : 92%, ENSMUSG00000032113, species_id: MOUSE, 93%, ENSRNOG00000031896, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and…
SERPINE2 Monoclonal Antibody (OTI1G8), TrueMAB™
Product Name : SERPINE2 Monoclonal Antibody (OTI1G8), TrueMAB™Species Reactivity: HumanHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: OTI1G8Conjugate : UnconjugatedForm: liquidConcentration : 0.81 mg/mLPurification : Affinity chromatographyStorage buffer: PBS with 1%…
centromere protein B, 80kDa
Product Name : centromere protein B, 80kDaTarget gene : CENPBverified_species_reactivity : Humaninterspecies_information : 100%, ENSMUSG00000068267, species_id: MOUSE, 100%, ENSRNOG00000057284, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
SEPT7 Polyclonal Antibody, FITC
Product Name : SEPT7 Polyclonal Antibody, FITCSpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : FITCForm: LiquidConcentration : 0.5-1.5 mg/mLPurification : Affinity chromatographyStorage buffer: proprietary buffer,…
cell division cycle associated 8
Product Name : cell division cycle associated 8Target gene : CDCA8verified_species_reactivity : Humaninterspecies_information : 81%, ENSMUSG00000028873, species_id: MOUSE, 82%, ENSRNOG00000031431, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40%…
SEC24D Polyclonal Antibody, Biotin
Product Name : SEC24D Polyclonal Antibody, BiotinSpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : BiotinForm: LiquidConcentration : 0.5-1.5 mg/mLPurification : Affinity chromatographyStorage buffer: proprietary buffer,…
CD82 molecule
Product Name : CD82 moleculeTarget gene : CD82verified_species_reactivity : Humaninterspecies_information : 90%, ENSMUSG00000027215, species_id: MOUSE, 90%, ENSRNOG00000000047, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and PBS…
SDSL Monoclonal Antibody (2F8-6C9)
Product Name : SDSL Monoclonal Antibody (2F8-6C9)Species Reactivity: HumanHost/Isotype : Mouse / IgG2a, kappaClass:MonoclonalType : AntibodyClone: 2F8-6C9Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: PBS, pH 7.4Contains :…
coiled-coil domain containing 82
Product Name : coiled-coil domain containing 82Target gene : CCDC82verified_species_reactivity : Humaninterspecies_information : 88%, ENSMUSG00000079084, species_id: MOUSE, 85%, ENSRNOG00000005713, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
SCN10A Polyclonal Antibody
Product Name : SCN10A Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.37 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH 7.3, with…
chromobox homolog 2
Product Name : chromobox homolog 2Target gene : CBX2verified_species_reactivity : Humaninterspecies_information : 77%, ENSMUSG00000025577, species_id: MOUSE, 76%, ENSRNOG00000049215, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and…
SATB2 Recombinant Rabbit Monoclonal Antibody (SATB2, 4374R)
Product Name : SATB2 Recombinant Rabbit Monoclonal Antibody (SATB2, 4374R)Species Reactivity: HumanHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: SATB2, 4374RConjugate : UnconjugatedForm: LiquidConcentration : 200 µg/mLPurification : Protein A/GStorage…
caspase recruitment domain family, member 19
Product Name : caspase recruitment domain family, member 19Target gene : CARD19verified_species_reactivity : Humaninterspecies_information : 98%, ENSMUSG00000037960, species_id: MOUSE, 95%, ENSRNOG00000016560, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer :…
SARS-CoV-2 Spike Protein S2 Recombinant Llama Monoclonal Antibody (P1B8)
Product Name : SARS-CoV-2 Spike Protein S2 Recombinant Llama Monoclonal Antibody (P1B8)Species Reactivity: VirusHost/Isotype : Llama / scFvClass:Recombinant MonoclonalType : AntibodyClone: P1B8Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Affinity chromatographyStorage…
complement component 9
Product Name : complement component 9Target gene : C9verified_species_reactivity : Humaninterspecies_information : 56%, ENSMUSG00000022149, species_id: MOUSE, 63%, ENSRNOG00000013736, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and…
SARS-CoV-2 Nucleocapsid protein Monoclonal Antibody (100000000)
Product Name : SARS-CoV-2 Nucleocapsid protein Monoclonal Antibody (100000000)Species Reactivity: VirusHost/Isotype : Mouse / IgGClass:MonoclonalType : AntibodyClone: 100000000Conjugate : Unconjugated View additional formats Biotin HRPForm: LiquidConcentration : 1 mg/mLPurification :…
chromosome 1 open reading frame 109
Product Name : chromosome 1 open reading frame 109Target gene : C1orf109verified_species_reactivity : Humaninterspecies_information : 34%, ENSMUSG00000020900, species_id: MOUSE, 84%, ENSRNOG00000025065, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer :…
SAH3 Polyclonal Antibody
Product Name : SAH3 Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: liquidConcentration : 1 mg/mLPurification : Antigen affinity chromatographyStorage buffer: phosphate/tris citrate, pH 7-8Contains…
butyrophilin, subfamily 3, member A3
Product Name : butyrophilin, subfamily 3, member A3Target gene : BTN3A3verified_species_reactivity : Humaninterspecies_information : 34%, ENSMUSG00000053216, species_id: MOUSE, 34%, ENSRNOG00000038877, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40%…
S100A9 Monoclonal Antibody (OTI11A12), TrueMAB™
Product Name : S100A9 Monoclonal Antibody (OTI11A12), TrueMAB™Species Reactivity: HumanHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: OTI11A12Conjugate : Unconjugated View additional formats BiotinForm: lyophilizedConcentration : 1 mg/mLPurification : Affinity chromatographyStorage…
biorientation of chromosomes in cell division 1-like 1
Product Name : biorientation of chromosomes in cell division 1-like 1Target gene : BOD1L1verified_species_reactivity : Humaninterspecies_information : 86%, ENSMUSG00000061755, species_id: MOUSE, 84%, ENSRNOG00000050437, species_id: RATclonality : Polyclonalisotype : IgGhost :…
Rubella Virus E2 Monoclonal Antibody (D92G)
Product Name : Rubella Virus E2 Monoclonal Antibody (D92G)Species Reactivity: VirusHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: D92GConjugate : UnconjugatedForm: LiquidConcentration : 100 µg/mLPurification : Protein AStorage buffer: PBS, pH…
BEN domain containing 2
Product Name : BEN domain containing 2Target gene : BEND2verified_species_reactivity : Humaninterspecies_information : 21%, ENSMUSG00000030094, species_id: MOUSE, 21%, ENSRNOG00000008658, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Ranibizumab Monoclonal Antibody (10D12)
Product Name : Ranibizumab Monoclonal Antibody (10D12)Species Reactivity: ChemicalHost/Isotype : Mouse / IgG1, kappaClass:MonoclonalType : AntibodyClone: 10D12Conjugate : UnconjugatedForm: LyophilizedConcentration : Purification : Protein AStorage buffer: PBS, pH 7.4Contains :…
Relaxin 1 Monoclonal Antibody (351713)
Product Name : Relaxin 1 Monoclonal Antibody (351713)Species Reactivity: HumanHost/Isotype : Mouse / IgG2BClass:MonoclonalType : AntibodyClone: 351713Conjugate : UnconjugatedForm: LyophilizedConcentration : 0.5 mg/mLPurification : Protein A/GStorage buffer: PBS with 5%…
ATPase, aminophospholipid transporter (APLT), class I, type 8A, member 1
Product Name : ATPase, aminophospholipid transporter (APLT), class I, type 8A, member 1Target gene : ATP8A1verified_species_reactivity : Humaninterspecies_information : 100%, ENSMUSG00000037685, species_id: MOUSE, 100%, ENSRNOG00000034200, species_id: RATclonality : Polyclonalisotype :…
RUNX1 Monoclonal Antibody (2B5)
Product Name : RUNX1 Monoclonal Antibody (2B5)Species Reactivity: HumanHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: 2B5Conjugate : UnconjugatedForm: LiquidConcentration : Conc. Not DeterminedPurification : Storage buffer: ascitesContains : 0.03% sodium…
zinc finger protein 585B
Product Name : zinc finger protein 585BTarget gene : ZNF585Bverified_species_reactivity : Humaninterspecies_information : 57%, ENSMUSG00000058186, species_id: MOUSE, 48%, ENSRNOG00000052406, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
RSRC1 Polyclonal Antibody
Product Name : RSRC1 Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.67 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH 7.3, with…
ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide
Product Name : ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptideTarget gene : ATP5Bverified_species_reactivity : Humaninterspecies_information : 95%, ENSMUSG00000025393, species_id: MOUSE, 95%, ENSRNOG00000002840, species_id: RATclonality : Polyclonalisotype : IgGhost…
zinc finger protein 175
Product Name : zinc finger protein 175Target gene : ZNF175verified_species_reactivity : Humaninterspecies_information : 39%, ENSMUSG00000056592, species_id: MOUSE, 42%, ENSRNOG00000023233, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
RPL18A Monoclonal Antibody (6G6G10)
Product Name : RPL18A Monoclonal Antibody (6G6G10)Species Reactivity: Human, MouseHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: 6G6G10Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein GStorage buffer: PBSContains : 0.05%…
zinc finger and AT hook domain containing
Product Name : zinc finger and AT hook domain containingTarget gene : ZFATverified_species_reactivity : Humaninterspecies_information : 60%, ENSMUSG00000022335, species_id: MOUSE, 61%, ENSRNOG00000025140, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer…
RNF13 Polyclonal Antibody
Product Name : RNF13 Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH 7, with…
zinc finger and BTB domain containing 18
Product Name : zinc finger and BTB domain containing 18Target gene : ZBTB18verified_species_reactivity : Humaninterspecies_information : 99%, ENSMUSG00000063659, species_id: MOUSE, 98%, ENSRNOG00000004423, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer…
RNH1 Polyclonal Antibody, MaxPab™
Product Name : RNH1 Polyclonal Antibody, MaxPab™Species Reactivity: HumanHost/Isotype : Mouse / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: PBS, pH 7.4Contains : no…
WD and tetratricopeptide repeats 1
Product Name : WD and tetratricopeptide repeats 1Target gene : WDTC1verified_species_reactivity : Humaninterspecies_information : 100%, ENSMUSG00000037622, species_id: MOUSE, 100%, ENSRNOG00000008377, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40%…
RNF2 Recombinant Rabbit Monoclonal Antibody (13H1L14)
Product Name : RNF2 Recombinant Rabbit Monoclonal Antibody (13H1L14)Species Reactivity: HumanHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: 13H1L14Conjugate : UnconjugatedForm: LiquidConcentration : 0.5 mg/mLPurification : Protein AStorage buffer: PBS,…
WBP2 N-terminal like
Product Name : WBP2 N-terminal likeTarget gene : WBP2NLverified_species_reactivity : Humaninterspecies_information : 71%, ENSMUSG00000022455, species_id: MOUSE, 72%, ENSRNOG00000008038, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and…
RLTPR Polyclonal Antibody
Product Name : RLTPR Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.1 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH 7.2, with…
astrotactin 2
Product Name : astrotactin 2Target gene : ASTN2verified_species_reactivity : Humaninterspecies_information : 99%, ENSMUSG00000028373, species_id: MOUSE, 99%, ENSRNOG00000060105, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and PBS…
Clazakizumab Biosimilar
Product Name : Clazakizumab BiosimilarHost species : HumanizedSpecies reactivity : HumanForm: LiquidStorage buffer : 0.01M PBS, pH 7.4.Concentration: 1.55 mg/mlPurity : >95% by SDS-PAGE.Clonality: MonoclonalApplications : Research Grade BiosimilarTarget :…
uroplakin 2
Product Name : uroplakin 2Target gene : UPK2verified_species_reactivity : Humaninterspecies_information : 84%, ENSMUSG00000041523, species_id: MOUSE, 85%, ENSRNOG00000043324, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and PBS…
Albiglutide Biosimilar
Product Name : Albiglutide BiosimilarHost species : Homo sapiensSpecies reactivity : HumanForm: LiquidStorage buffer : 0.01M PBS, pH 7.4.Concentration: 0.5 mg/mlPurity : >95% by SDS-PAGE.Clonality: Applications : Research Grade BiosimilarTarget…
H4K20me3 Recombinant Rabbit Monoclonal Antibody (1E6)
Product Name : H4K20me3 Recombinant Rabbit Monoclonal Antibody (1E6)Species Reactivity: HumanHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: 1E6Conjugate : UnconjugatedForm: LiquidConcentration : 1.7 mg/mLPurification : Antigen affinity chromatographyStorage buffer:…
tetratricopeptide repeat domain 12
Product Name : tetratricopeptide repeat domain 12Target gene : TTC12verified_species_reactivity : Humaninterspecies_information : 73%, ENSMUSG00000040219, species_id: MOUSE, 81%, ENSRNOG00000008595, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
tripartite motif containing 60
Product Name : tripartite motif containing 60Target gene : TRIM60verified_species_reactivity : Humaninterspecies_information : 54%, ENSMUSG00000053490, species_id: MOUSE, 42%, ENSRNOG00000000785, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Granzyme K Monoclonal Antibody (G3H69), PerCP-eFluor™ 710, eBioscience™
Product Name : Granzyme K Monoclonal Antibody (G3H69), PerCP-eFluor™ 710, eBioscience™Species Reactivity: HumanHost/Isotype : Mouse / IgG2a, kappaClass:MonoclonalType : AntibodyClone: G3H69Conjugate : PerCP-eFluor™ 710 View additional formats eFluor 660 PEForm:…
tripartite motif containing 39
Product Name : tripartite motif containing 39Target gene : TRIM39verified_species_reactivity : Humaninterspecies_information : 93%, ENSMUSG00000045409, species_id: MOUSE, 94%, ENSRNOG00000000785, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
TNFAIP3 interacting protein 3
Product Name : TNFAIP3 interacting protein 3Target gene : TNIP3verified_species_reactivity : Humaninterspecies_information : 46%, ENSMUSG00000020400, species_id: MOUSE, 46%, ENSRNOG00000010370, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
Glucose Transporter GLUT10 Polyclonal Antibody, Biotin
Product Name : Glucose Transporter GLUT10 Polyclonal Antibody, BiotinSpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : BiotinForm: LiquidConcentration : 0.5-1.5 mg/mLPurification : Affinity chromatographyStorage buffer:…
transmembrane protein 8C
Product Name : transmembrane protein 8CTarget gene : TMEM8Cverified_species_reactivity : Humaninterspecies_information : 91%, ENSMUSG00000009214, species_id: MOUSE, 41%, ENSRNOG00000015226, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and…
Galectin-3 Monoclonal Antibody (1C1B2), CoraLite® Plus 647
Product Name : Galectin-3 Monoclonal Antibody (1C1B2), CoraLite® Plus 647Species Reactivity: Human, Mouse, RatHost/Isotype : Mouse / IgG2bClass:MonoclonalType : AntibodyClone: 1C1B2Conjugate : CoraLite® Plus 647 View additional formats CoraLite 555…
transmembrane 6 superfamily member 2
Product Name : transmembrane 6 superfamily member 2Target gene : TM6SF2verified_species_reactivity : Humaninterspecies_information : 92%, ENSMUSG00000036151, species_id: MOUSE, 88%, ENSRNOG00000042237, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40%…
GTF2H3 Monoclonal Antibody (OTI4B5), TrueMAB™
Product Name : GTF2H3 Monoclonal Antibody (OTI4B5), TrueMAB™Species Reactivity: Human, Mouse, RatHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: OTI4B5Conjugate : UnconjugatedForm: lyophilizedConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS,…
transglutaminase 2
Product Name : transglutaminase 2Target gene : TGM2verified_species_reactivity : Humaninterspecies_information : 75%, ENSMUSG00000037820, species_id: MOUSE, 79%, ENSRNOG00000012956, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and PBS…
GSTK1 Polyclonal Antibody, MaxPab™
Product Name : GSTK1 Polyclonal Antibody, MaxPab™Species Reactivity: HumanHost/Isotype : Mouse / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: PBS, pH 7.4Contains : no…
GSK-3 Beta Monoclonal Antibody (4C6), HRP
Product Name : GSK-3 Beta Monoclonal Antibody (4C6), HRPSpecies Reactivity: Human, Mouse, RatHost/Isotype : Mouse / IgGClass:MonoclonalType : AntibodyClone: 4C6Conjugate : HRP View additional formats Alexa Fluor 350 Alexa Fluor…
T-box 5
Product Name : T-box 5Target gene : TBX5verified_species_reactivity : Humaninterspecies_information : 92%, ENSMUSG00000018263, species_id: MOUSE, 92%, ENSRNOG00000001399, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and PBS…
GRF-1 Polyclonal Antibody
Product Name : GRF-1 Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.2 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH 7.2, with…
synaptotagmin II
Product Name : synaptotagmin IITarget gene : SYT2verified_species_reactivity : Humaninterspecies_information : 100%, ENSMUSG00000026452, species_id: MOUSE, 100%, ENSRNOG00000004756, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and PBS…
syntaxin binding protein 4
Product Name : syntaxin binding protein 4Target gene : STXBP4verified_species_reactivity : Humaninterspecies_information : 83%, ENSMUSG00000020546, species_id: MOUSE, 81%, ENSRNOG00000032768, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
GPR142 Polyclonal Antibody
Product Name : GPR142 Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.21 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH 7.3, with…
splicing regulatory glutamine/lysine-rich protein 1
Product Name : splicing regulatory glutamine/lysine-rich protein 1Target gene : SREK1verified_species_reactivity : Humaninterspecies_information : 100%, ENSMUSG00000032621, species_id: MOUSE, 100%, ENSRNOG00000032735, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40%…
SPOC domain containing 1
Product Name : SPOC domain containing 1Target gene : SPOCD1verified_species_reactivity : Humaninterspecies_information : 56%, ENSMUSG00000028784, species_id: MOUSE, 31%, ENSRNOG00000011756, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
GNL3 Monoclonal Antibody (OTI5B1), TrueMAB™
Product Name : GNL3 Monoclonal Antibody (OTI5B1), TrueMAB™Species Reactivity: HumanHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: OTI5B1Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein A/GStorage buffer: PBS with 50%…
sorting nexin 8
Product Name : sorting nexin 8Target gene : SNX8verified_species_reactivity : Humaninterspecies_information : 93%, ENSMUSG00000029560, species_id: MOUSE, 93%, ENSRNOG00000001258, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and…
Anti-Human OSM/Oncostatin-M Biosimilar
Product Name : Anti-Human OSM/Oncostatin-M BiosimilarHost species : HumanSpecies reactivity : HumanForm: LiquidStorage buffer : 0.01M PBS, pH 7.4.Concentration: 1 mg/mlPurity : >95% by SDS-PAGE.Clonality: MonoclonalApplications : Research Grade BiosimilarTarget…
small integral membrane protein 24
Product Name : small integral membrane protein 24Target gene : SMIM24verified_species_reactivity : Humaninterspecies_information : 44%, ENSMUSG00000078439, species_id: MOUSE, 44%, ENSRNOG00000048878, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40%…
Visilizumab Biosimilar
Product Name : Visilizumab BiosimilarHost species : HumanizedSpecies reactivity : HumanForm: LiquidStorage buffer : 0.01M PBS, pH 7.4.Concentration: 1 mg/mlPurity : >95% by SDS-PAGE.Clonality: MonoclonalApplications : Research Grade BiosimilarTarget :…
solute carrier family 9, subfamily A (NHE9, cation proton antiporter 9), member 9
Product Name : solute carrier family 9, subfamily A (NHE9, cation proton antiporter 9), member 9Target gene : SLC9A9verified_species_reactivity : Humaninterspecies_information : 85%, ENSMUSG00000031129, species_id: MOUSE, 87%, ENSRNOG00000008554, species_id: RATclonality…
Teplizumab Biosimilar
Product Name : Teplizumab BiosimilarHost species : HumanizedSpecies reactivity : HumanForm: LiquidStorage buffer : 0.01M PBS, pH 7.4.Concentration: 1 mg/mlPurity : >95% by SDS-PAGE.Clonality: MonoclonalApplications : Research Grade BiosimilarTarget :…
aquaporin 4
Product Name : aquaporin 4Target gene : AQP4verified_species_reactivity : Humaninterspecies_information : 93%, ENSMUSG00000024411, species_id: MOUSE, 92%, ENSRNOG00000016043, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and PBS…
IPH4301 Biosimilar
Product Name : IPH4301 BiosimilarHost species : HumanSpecies reactivity : HumanForm: LiquidStorage buffer : 0.01M PBS, pH 7.4.Concentration: 1 mg/mlPurity : >95% by SDS-PAGE.Clonality: MonoclonalApplications : Research Grade BiosimilarTarget :…
SLAM family member 7
Product Name : SLAM family member 7Target gene : SLAMF7verified_species_reactivity : Humaninterspecies_information : 49%, ENSMUSG00000038179, species_id: MOUSE, 43%, ENSRNOG00000023209, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
SH3KBP1 binding protein 1
Product Name : SH3KBP1 binding protein 1Target gene : SHKBP1verified_species_reactivity : Humaninterspecies_information : 96%, ENSMUSG00000089832, species_id: MOUSE, 94%, ENSRNOG00000020882, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
SUMO1/sentrin specific peptidase 1
Product Name : SUMO1/sentrin specific peptidase 1Target gene : SENP1verified_species_reactivity : Humaninterspecies_information : 83%, ENSMUSG00000033075, species_id: MOUSE, 82%, ENSRNOG00000022260, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
secretoglobin, family 2A, member 1
Product Name : secretoglobin, family 2A, member 1Target gene : SCGB2A1verified_species_reactivity : Humaninterspecies_information : 35%, ENSMUSG00000096872, species_id: MOUSE, 32%, ENSRNOG00000020305, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40%…
anti-CD3 / X antibody, HuiYu Pharma
Product Name : CD3UndisclosedTarget points: Huiyu PharmaceuticalStatus: Organization : Short name : Type: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two…
sterile alpha motif domain containing 1
Product Name : sterile alpha motif domain containing 1Target gene : SAMD1verified_species_reactivity : Humaninterspecies_information : 98%, ENSMUSG00000079003, species_id: MOUSE, 98%, ENSRNOG00000052637, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer :…
anti-TrkA antibody, 4B Technologies
Product Name : TrkATarget points: 4B TechnologiesStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of…
arginine/serine-rich protein 1
Product Name : arginine/serine-rich protein 1Target gene : RSRP1verified_species_reactivity : Humaninterspecies_information : 65%, ENSMUSG00000037266, species_id: MOUSE, 63%, ENSRNOG00000017309, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and…
anti-Claudin 18.2 antibody,Jiangsu Hengrui
Product Name : CLDN18.2Target points: Hengrui PharmaceuticalsShanghai HengruiStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist…
ribosomal protein L32
Product Name : ribosomal protein L32Target gene : RPL32verified_species_reactivity : Humaninterspecies_information : 97%, ENSMUSG00000057841, species_id: MOUSE, 97%, ENSRNOG00000032605, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and…
anti-EGFRvIII CAR, Noile-Immune Biotech
Product Name : EGFRVIIITarget points: Noile-ImmuneStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two…
annexin A6
Product Name : annexin A6Target gene : ANXA6verified_species_reactivity : Humaninterspecies_information : 98%, ENSMUSG00000018340, species_id: MOUSE, 98%, ENSRNOG00000010668, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and PBS…
anti-CD3 antibody, Moffitt Cancer Center
Product Name : CD3Target points: Moffitt Cancer CenterStatus: CD3Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist…
RAS-like, estrogen-regulated, growth inhibitor
Product Name : RAS-like, estrogen-regulated, growth inhibitorTarget gene : RERGverified_species_reactivity : Humaninterspecies_information : 98%, ENSMUSG00000030222, species_id: MOUSE, 98%, ENSRNOG00000027592, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
GTB-5550
Product Name : B7-H3CD16Target points: GT BiopharmaUniversity of MinnesotaStatus: Organization : Short name : Type: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist…
ring finger and CHY zinc finger domain containing 1
Product Name : ring finger and CHY zinc finger domain containing 1Target gene : RCHY1verified_species_reactivity : Humaninterspecies_information : 87%, ENSMUSG00000029397, species_id: MOUSE, 84%, ENSRNOG00000002546, species_id: RATclonality : Polyclonalisotype : IgGhost…
PY159
Product Name : TREM-1Target points: GileadPionyr ImmunotherapeuticsStatus: TREM-1Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of…
RAB23, member RAS oncogene family
Product Name : RAB23, member RAS oncogene familyTarget gene : RAB23verified_species_reactivity : Humaninterspecies_information : 96%, ENSMUSG00000004768, species_id: MOUSE, 96%, ENSRNOG00000012629, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40%…
anti-SIRPA antibody, Byondis
Product Name : SIRPATarget points: ByondisStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two…
protein tyrosine phosphatase, non-receptor type 13
Product Name : protein tyrosine phosphatase, non-receptor type 13Target gene : PTPN13verified_species_reactivity : Humaninterspecies_information : 75%, ENSMUSG00000034573, species_id: MOUSE, 73%, ENSRNOG00000002061, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer :…
ACE Monoclonal Antibody (6A4)
Product Name : ACE Monoclonal Antibody (6A4)Species Reactivity: HumanHost/Isotype : Mouse / IgG1, kappaClass:MonoclonalType : AntibodyClone: 6A4Conjugate : UnconjugatedForm: LiquidConcentration : See LabelPurification : Affinity chromatographyStorage buffer: PBS, pH 7.4Contains…
proteasome subunit beta 9
Product Name : proteasome subunit beta 9Target gene : PSMB9verified_species_reactivity : Humaninterspecies_information : 88%, ENSMUSG00000096727, species_id: MOUSE, 91%, ENSRNOG00000000459, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
anti-Trop-2 ADC, Levena
Product Name : TACSTD-2/Trop2Target points: Levena BiopharmaStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of…
protein arginine methyltransferase 9
Product Name : protein arginine methyltransferase 9Target gene : PRMT9verified_species_reactivity : Humaninterspecies_information : 92%, ENSMUSG00000037134, species_id: MOUSE, 89%, ENSRNOG00000012928, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
ACBD6 Polyclonal Antibody
Product Name : ACBD6 Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH 7.4,…
protein phosphatase 1, regulatory subunit 13 like
Product Name : protein phosphatase 1, regulatory subunit 13 likeTarget gene : PPP1R13Lverified_species_reactivity : Humaninterspecies_information : 92%, ENSMUSG00000040734, species_id: MOUSE, 92%, ENSRNOG00000025350, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer…
anti-LIF antibody, Medimmune
Product Name : LIFTarget points: MedimmuneStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two…
polymerase (RNA) II (DNA directed) polypeptide I, 14.5kDa
Product Name : polymerase (RNA) II (DNA directed) polypeptide I, 14.5kDaTarget gene : POLR2Iverified_species_reactivity : Humaninterspecies_information : 100%, ENSMUSG00000019738, species_id: MOUSE, 100%, ENSRNOG00000050560, species_id: RATclonality : Polyclonalisotype : IgGhost :…
Pertuzumab ScFv, Isfahan University of Medical Sciences
Product Name : HER2/neuTarget points: Isfahan University of Medical SciencesStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream.…
phospholipid phosphatase 1
Product Name : phospholipid phosphatase 1Target gene : PLPP1verified_species_reactivity : Humaninterspecies_information : 65%, ENSMUSG00000021759, species_id: MOUSE, 62%, ENSRNOG00000009980, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and…
PF-06888667
Product Name : HER2/neuTarget points: PfizerStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two…
phospholipase C, beta 3 (phosphatidylinositol-specific)
Product Name : phospholipase C, beta 3 (phosphatidylinositol-specific)Target gene : PLCB3verified_species_reactivity : Humaninterspecies_information : 81%, ENSMUSG00000024960, species_id: MOUSE, 84%, ENSRNOG00000021150, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40%…
anti-GPC3 antibody, Jiangsu Simcere
Product Name : GPC3Target points: SimcereStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two…
phosphatidylinositol 4-kinase, catalytic, alpha
Product Name : phosphatidylinositol 4-kinase, catalytic, alphaTarget gene : PI4KAverified_species_reactivity : Humaninterspecies_information : 100%, ENSMUSG00000041720, species_id: MOUSE, 100%, ENSRNOG00000060045, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
anti-CD47 antibody, Doma Biopharmaceutical
Product Name : CD47Target points: Doma BiopharmaceuticalStatus: CD47Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of…
peroxisomal biogenesis factor 12
Product Name : peroxisomal biogenesis factor 12Target gene : PEX12verified_species_reactivity : Humaninterspecies_information : 65%, ENSMUSG00000018733, species_id: MOUSE, 69%, ENSRNOG00000052864, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol…
anti-CD38/BCMA antibody, Virtuoso
Product Name : BCMACD38Target points: VirtuosoStatus: Organization : Short name : Type: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light…
programmed cell death 4 (neoplastic transformation inhibitor)
Product Name : programmed cell death 4 (neoplastic transformation inhibitor)Target gene : PDCD4verified_species_reactivity : Humaninterspecies_information : 98%, ENSMUSG00000024975, species_id: MOUSE, 98%, ENSRNOG00000014779, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer…
anti-ApoE antibody, Massachusetts General Hospital
Product Name : ApoETarget points: Massachusetts General HospitalStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist…
prostate and breast cancer overexpressed 1
Product Name : prostate and breast cancer overexpressed 1Target gene : PBOV1verified_species_reactivity : Humaninterspecies_information : 25%, ENSMUSG00000036097, species_id: MOUSE, 23%, ENSRNOG00000016146, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer :…
anti-Interferon Gamma antibody, Elixiron Immunotherapeutics
Product Name : IFN-γTarget points: Elixiron ImmunotherapeuticsStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of…
OTU deubiquitinase with linear linkage specificity
Product Name : OTU deubiquitinase with linear linkage specificityTarget gene : OTULINverified_species_reactivity : Humaninterspecies_information : 93%, ENSMUSG00000046034, species_id: MOUSE, 89%, ENSRNOG00000012017, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer :…
BSI-029
Product Name : UnspecfiedTarget points: BiosynergicsStatus: UnspecfiedOrganization : UnknownShort name : 0Type: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light…
oligophrenin 1
Product Name : oligophrenin 1Target gene : OPHN1verified_species_reactivity : Humaninterspecies_information : 77%, ENSMUSG00000031214, species_id: MOUSE, 74%, ENSRNOG00000026573, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and PBS…
anti-FLT4 antibody, Vegenics
Product Name : FLT4Target points: VegenicsStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two…
neurotensin
Product Name : neurotensinTarget gene : NTSverified_species_reactivity : Humaninterspecies_information : 75%, ENSMUSG00000019890, species_id: MOUSE, 70%, ENSRNOG00000004179, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and PBS (pH…
anti-APCDD1 antibody, Stemcentrx
Product Name : APCDD1Target points: StemcentrxStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two…
neutral sphingomyelinase (N-SMase) activation associated factor
Product Name : neutral sphingomyelinase (N-SMase) activation associated factorTarget gene : NSMAFverified_species_reactivity : Humaninterspecies_information : 97%, ENSMUSG00000028245, species_id: MOUSE, 100%, ENSRNOG00000010234, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer :…
evorpacept
Product Name : CD47Target points: ALX OncologyMerck Sharp DohmeZymeworksStatus: CD47Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies…
neurofibromin 1
Product Name : neurofibromin 1Target gene : NF1verified_species_reactivity : Humaninterspecies_information : 91%, ENSMUSG00000020716, species_id: MOUSE, 91%, ENSRNOG00000013780, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and PBS…
anti-CD34 antibody, 3S Bio
Product Name : CD34Target points: 3SBioStatus: CD34Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two…
NIMA-related kinase 1
Product Name : NIMA-related kinase 1Target gene : NEK1verified_species_reactivity : Humaninterspecies_information : 72%, ENSMUSG00000031644, species_id: MOUSE, 71%, ENSRNOG00000010418, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and…
DAG-6F4
Product Name : Alpha-dystroglycanTarget points: Robert Jones and Agnes Hunt Orthopaedic HospitalStatus: Alpha-dystroglycanOrganization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into…
nuclear autoantigenic sperm protein (histone-binding)
Product Name : nuclear autoantigenic sperm protein (histone-binding)Target gene : NASPverified_species_reactivity : Humaninterspecies_information : 47%, ENSMUSG00000028693, species_id: MOUSE, 48%, ENSRNOG00000016454, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40%…
anti-MELK antibody, Oncotherapy Science
Product Name : MELKTarget points: OncotherapyStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two…
N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase
Product Name : N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidaseTarget gene : NAGPAverified_species_reactivity : Humaninterspecies_information : 89%, ENSMUSG00000023143, species_id: MOUSE, 92%, ENSRNOG00000002895, species_id: RATclonality : Polyclonalisotype : IgGhost : Rabbitbuffer : 40% glycerol and PBS…
anti-EPO antibody, Novartis
Product Name : EPOTarget points: NovartisStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two…
anti-CD94 antibody, University of Texas
Product Name : NKG2ATarget points: University of Texas at AustinStatus: NKG2AOrganization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream.…
anti-Fibronectin antibody,Medarex
Product Name : FibronectinTarget points: MedarexStatus: FibronectinOrganization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two…
Ralimetinib is a Selective and Oral Active p38 MAPK Inhibitor with Antitumor Activity
Nowadays, cancer has become no stranger to people. We mentioned it many times in our blogs. p38 MAPK (p38 mitogen-activated protein kinase) are a group of kinases responsive to stress stimuli.…
mPEG6-SH
Product Name : mPEG6-SHFull Name: 2,5,8,11,14,17-Hexaoxanonadecane-19-thiolSynonyms : mPEG6-SHCAS:441771-60-4Molecular formula : C13H28O6SMolecular Weight: 312.42Appearance: Colorless LiquidStorage: -18℃ for long term storage, avoid light and oxygen658-48-0 custom synthesis 3034880-93-5 supplier PMID:31335091 MedChemExpress…
anti-FGFR4 antibody, Licentia
Product Name : FGFR4Target points: LicentiaStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two…
Methyltetrazine-CH2NHCO-PEG2-CH2CH2NHBoc
Product Name : Methyltetrazine-CH2NHCO-PEG2-CH2CH2NHBocFull Name: Methyltetrazine-CH2NHCO-PEG2-CH2CH2NHBocSynonyms : Methyltetrazine-CH2NHCO-PEG2-CH2CH2NHBocCAS:Molecular formula : C22H32N6O5Molecular Weight: 460.2423014-07-5 web 53Appearance: Storage: -18℃ for long term storage1380723-44-3 In stock PMID:30085521 MedChemExpress (MCE) offers a wide range…
Pertuzumab biosimilar -JHL biotech
Product Name : HER2/neuTarget points: JHL BiotechStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of…
14-3-3 sigma Monoclonal Antibody (3F10D9)
Product Name : 14-3-3 sigma Monoclonal Antibody (3F10D9)Species Reactivity: HumanHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: 3F10D9Conjugate : Unconjugated View additional formats CoraLite 555 CoraLite 594 CoraLite Plus 488Form: LiquidConcentration…
A Novel Potent and Specific BET Inhibitor Y06036 For Prostate Cancer
Prostate cancer is the most common malignancy and the fifth leading cause of death from malignancy in men. Since androgen receptor (AR) signaling has a pivotal role in prostate cancer, androgen…
anti-Osteopontin antibody, iroshima University
Product Name : OsteopontinTarget points: Hiroshima UniversityStatus: OsteopontinOrganization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of…
Rabbit anti-TSG101 Polyclonal Antibody
Product Name : Rabbit anti-TSG101 Polyclonal AntibodySynonym : TSG101; Tumor susceptibility gene 101 protein; ESCRT-I complex subunit TSG101Host : RabbitSpecies Reactivity: Human, Mouse, RatSpecificity : Predicted Reactivity: Applications : WB:…
bermekimab
Product Name : IL-1αTarget points: XBiotechJohnson & JohnsonStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist…
Rabbit anti-TRPM7 Polyclonal Antibody(N-term)
Product Name : Rabbit anti-TRPM7 Polyclonal Antibody(N-term)Synonym : Transient receptor potential cation channel subfamily M member 7; Channel-kinase 1; Long transient receptor potential channel 7; LTrpC-7; LTrpC7; TRPM7; CHAK1; LTRPC7Host…
ibritumomab tiuxetan
Product Name : CD20Target points: BiogenCASI PharmaceuticalsCTI BiopharmaSpectrumStatus: CD20Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist…
Rabbit anti-SELP Polyclonal Antibody
Product Name : Rabbit anti-SELP Polyclonal AntibodySynonym : CD62; CD62P; GMP140; GRMP; LECAM3; PADGEM; PSELHost : RabbitSpecies Reactivity: Human, RatSpecificity : Predicted Reactivity: Applications : WB 1:500 - 1:2000IHC 1:50…
anti-CXCL7 antibody, CNRS
Product Name : CXCL7Target points: The French National Centre for Scientific ResearchStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into…
CNTO 4088
Product Name : Interleukin 23Target points: Centocor Ortho BiotechStatus: Interleukin 23Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream.…
Rabbit anti-PCK1 Polyclonal Antibody
Product Name : Rabbit anti-PCK1 Polyclonal AntibodySynonym : PEPCK-C; PEPCK1; PEPCKCHost : RabbitSpecies Reactivity: Mouse, RatSpecificity : Predicted Reactivity: Applications : WB 1:500 - 1:2000Immunogen: A synthetic peptide of human…
anti-TIM3 antibody, BMS
Product Name : TIM-3Target points: Bristol Myers SquibbStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist…
Rabbit anti-MBTPS2 Polyclonal Antibody(N-term)
Product Name : Rabbit anti-MBTPS2 Polyclonal Antibody(N-term)Synonym : Membrane-bound transcription factor site-2 protease; Endopeptidase S2P; Sterol regulatory element-binding proteins intramembrane protease; SREBPs intramembrane protease; MBTPS2; S2PHost : RabbitSpecies Reactivity: HumanSpecificity…
anti-CD3/FAPalpha antibody, Amgen
Product Name : CD3FAPTarget points: AmgenStatus: Organization : Short name : Type: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light…
Rabbit anti-GPR45 Polyclonal Antibody(Center)
Product Name : Rabbit anti-GPR45 Polyclonal Antibody(Center)Synonym : Probable G-protein coupled receptor 45; PSP24-1; PSP24-alpha; GPR45Host : RabbitSpecies Reactivity: HumanSpecificity : This GPR45 antibody is generated from rabbits immunized with…
anti-Her2 antibody, AbMax
Product Name : HER2/neuTarget points: AbMaxStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two…
Rabbit anti-ELK3 Polyclonal Antibody(N-term)
Product Name : Rabbit anti-ELK3 Polyclonal Antibody(N-term)Synonym : ETS domain-containing protein Elk-3; ETS-related protein ERP; ETS-related protein NET; Serum response factor accessory protein 2; SAP-2; SRF accessory protein 2; ELK3;…
adalimumab biosimilar, Adello
Product Name : TNFαTarget points: AdelloStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two…
Rabbit anti-ASPG Polyclonal Antibody(Center)
Product Name : Rabbit anti-ASPG Polyclonal Antibody(Center)Synonym : 60 kDa lysophospholipase; L-asparaginase; L-asparagine amidohydrolase; Platelet-activating factor acetylhydrolase; PAF acetylhydrolase; ASPG; C14orf76Host : RabbitSpecies Reactivity: HumanSpecificity : This ASPG antibody is…
BITR2101
Product Name : TNFR2Target points: BeiGeneBITTStatus: Organization : ProteinShort name : Homo sapiensType: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two…
Rabbit anti-MUC2 Monoclonal Antibody(JRMR-10155-63)
Product Name : Rabbit anti-MUC2 Monoclonal Antibody(JRMR-10155-63)Synonym : Mucin-2; SMUCHost : RabbitSpecies Reactivity: Human, Mouse, RatSpecificity : Predicted Reactivity: Applications : WB:1:500-1:2000,IHC-P:1:200-1:1000,FC:1:50-1:100Immunogen: Concentration : Purification : Protein AClonality: Monoclonal AntibodyStorage…
BGB B167
Product Name : 4-1BBCEATarget points: BeiGeneStatus: Organization : Short name : Type: Organism: Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light…
Ankyrin G Polyclonal Antibody
Product Name : Ankyrin G Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Goat / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.5 mg/mLPurification : Ammonium sulfate precipitationStorage buffer: TBS, pH 7.3,…
MGAT2-IN-2
Product Name : MGAT2-IN-2Description:MGAT2-IN-2 is a potent and selective acyl CoA:monoacylglycerol acyltransferase 2 (MGAT2) inhibitor with an IC50 of 3.4 nM.CAS: 1710630-11-7Molecular Weight:580.53Formula: C26H21F5N4O4SChemical Name: 5--7-(2-oxopyrrolidin-1-yl)-N--2,3-dihydro-1H-indole-1-carboxamideSmiles : O=C1CCCN1C1=CC(=CC2CCN(C=21)C(=O)NC1C=CC(=CC=1)C(F)(F)F)S(=O)(=O)NC1=CC=C(F)C=C1FInChiKey: RGDHGNPUKLLPLT-UHFFFAOYSA-NInChi :…
Amphiphysin Polyclonal Antibody
Product Name : Amphiphysin Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.31 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH…
DKM 2-93
Product Name : DKM 2-93Description:DKM 2-93 is a relatively selective inhibitor of UBA5 with an IC50 of 430 μM.CAS: 65836-72-8Molecular Weight:243.69Formula: C11H14ClNO3Chemical Name: 2-chloro-N-acetamideSmiles : COC1=CC=C(CNC(=O)CCl)C=C1OCInChiKey: CETPWRGZGWGPSV-UHFFFAOYSA-NInChi : InChI=1S/C11H14ClNO3/c1-15-9-4-3-8(5-10(9)16-2)7-13-11(14)6-12/h3-5H,6-7H2,1-2H3,(H,13,14)Purity: ≥98%…
Aldo-keto Reductase Family 1 Member B1 Monoclonal Antibody (CPTC-AKR1B1-2)
Product Name : Aldo-keto Reductase Family 1 Member B1 Monoclonal Antibody (CPTC-AKR1B1-2)Species Reactivity: HumanHost/Isotype : Mouse / IgG1, kappaClass:MonoclonalType : AntibodyClone: CPTC-AKR1B1-2Conjugate : UnconjugatedForm: LiquidConcentration : 200 µg/mLPurification : Protein…
Gabazine
Product Name : GabazineDescription:Gabazine is a selective and competitive antagonist of GABAA receptor, with an IC50 of ~0.2 μM for GABA receptor.CAS: 104104-50-9Molecular Weight:368.23Formula: C15H18BrN3O3Chemical Name: 4-butanoic acid hydrobromideSmiles :…
Adenovirus Type 3 Polyclonal Antibody
Product Name : Adenovirus Type 3 Polyclonal AntibodySpecies Reactivity: VirusHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBSContains :…
TLR7/8 agonist 1 dihydrochloride
Product Name : TLR7/8 agonist 1 dihydrochlorideDescription:TLR7/8 agonist 1 dihydrochloride is a toll-like receptor TLR7/TLR8 dual-agonistic imidazoquinoline.CAS: 1620278-72-9Molecular Weight:432.39Formula: C22H27Cl2N5Chemical Name: 1-methyl-2-butyl-1H-imidazoquinolin-4-amine dihydrochlorideSmiles : Cl.Cl.CCCCC1=NC2=C(C3=CC=CC=C3N=C2N)N1CC1=CC=C(CN)C=C1InChiKey: YKZCFKIAMHQQAW-UHFFFAOYSA-NInChi : InChI=1S/C22H25N5.2ClH/c1-2-3-8-19-26-20-21(17-6-4-5-7-18(17)25-22(20)24)27(19)14-16-11-9-15(13-23)10-12-16;;/h4-7,9-12H,2-3,8,13-14,23H2,1H3,(H2,24,25);2*1HPurity: ≥98% (or…
Acetylated Lysine Polyclonal Antibody
Product Name : Acetylated Lysine Polyclonal AntibodySpecies Reactivity: ChemicalHost/Isotype : RabbitClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.5-1.0 mg/mLPurification : Protein AStorage buffer: PBS, pH 7, with 50% glycerolContains…
CP-724714
Product Name : CP-724714Description:CP-724714 is An orally bioavailable quinazoline with potential antineoplastic activity. CP-724,714 selectively binds to the intracellular domain of HER2, reversibly inhibiting its tyrosine kinase activity and resulting…
ATR Monoclonal Antibody (1E9)
Product Name : ATR Monoclonal Antibody (1E9)Species Reactivity: HumanHost/Isotype : Mouse / IgG1, kappaClass:MonoclonalType : AntibodyClone: 1E9Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: PBS, pH 7.4Contains :…
CGP 25454A
Product Name : CGP 25454ADescription:CGP 25454A is a novel and selective presynaptic dopamine autoreceptor antagonist. In vitro: CGP 25454A increase the field-stimulated - and -overflow from rat striatal slices preloaded…
ATP6V1C2 Monoclonal Antibody (OTI6D5), TrueMAB™
Product Name : ATP6V1C2 Monoclonal Antibody (OTI6D5), TrueMAB™Species Reactivity: Human, Mouse, RatHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: OTI6D5Conjugate : UnconjugatedForm: lyophilizedConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS,…
TOFA
Product Name : TOFADescription:TOFA (RMI14514;MDL14514) is an allosteric inhibitor of acetyl-CoA carboxylase-α (ACCA ).CAS: 54857-86-2Molecular Weight:324.45Formula: C19H32O4Chemical Name: 5-(tetradecyloxy)furan-2-carboxylic acidSmiles : CCCCCCCCCCCCCCOC1=CC=C(O1)C(O)=OInChiKey: CZRCFAOMWRAFIC-UHFFFAOYSA-NInChi : InChI=1S/C19H32O4/c1-2-3-4-5-6-7-8-9-10-11-12-13-16-22-18-15-14-17(23-18)19(20)21/h14-15H,2-13,16H2,1H3,(H,20,21)Purity: ≥98% (or refer to the…
ATM Monoclonal Antibody (3E6F4)
Product Name : ATM Monoclonal Antibody (3E6F4)Species Reactivity: Human, RatHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: 3E6F4Conjugate : UnconjugatedForm: LiquidConcentration : 1000 µg/mLPurification : Protein AStorage buffer: PBS, pH 7.3,…
Lusaperidone
Product Name : LusaperidoneDescription:Lusaperidone (R107474) is an α2 adrenergic receptor antagonist with Kis of 0.13 and 0.15 nM for α2A and α2C, respectively.CAS: 214548-46-6Molecular Weight:359.42Formula: C22H21N3O2Chemical Name: 2-methyl-3-(2-8-oxa-4-azatricyclotrideca-1(13),2(7),9,11-tetraen-4-ylethyl)-4H-pyridopyrimidin-4-oneSmiles : CC1N=C2C=CC=CN2C(=O)C=1CCN1CC2C3=CC=CC=C3OC=2CC1InChiKey:…
ATAD1 Polyclonal Antibody
Product Name : ATAD1 Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.17 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH…
Ribocil-C
Product Name : Ribocil-CDescription:Ribocil-C is a highly selective inhibitor of bacterial riboflavin riboswitches.CAS: 1825355-56-3Molecular Weight:419.50Formula: C21H21N7OSChemical Name: 2-methylpiperidin-3-yl]-6-(thiophen-2-yl)-1,4-dihydropyrimidin-4-oneSmiles : O=C1C=C(NC(=N1)1CN(CC2=CN(C=N2)C2N=CC=CN=2)CCC1)C1=CC=CS1InChiKey: UVDVCDUBJWYRJW-HNNXBMFYSA-NInChi : InChI=1S/C21H21N7OS/c29-19-10-17(18-5-2-9-30-18)25-20(26-19)15-4-1-8-27(11-15)12-16-13-28(14-24-16)21-22-6-3-7-23-21/h2-3,5-7,9-10,13-15H,1,4,8,11-12H2,(H,25,26,29)/t15-/m0/s1Purity: ≥98% (or refer to the Certificate of…
ASF1A Monoclonal Antibody (2D4A6)
Product Name : ASF1A Monoclonal Antibody (2D4A6)Species Reactivity: Human, RatHost/Isotype : Mouse / IgG3Class:MonoclonalType : AntibodyClone: 2D4A6Conjugate : Unconjugated View additional formats CoraLite 594 CoraLite Plus 488Form: LiquidConcentration : 1000…
MRS-1191
Product Name : MRS-1191Description:MRS-1191 is a potent and selective A3 adenosine receptor antagonist with a KB value of 92 nM, a Ki value of 31.4 nM for human A3 receptor…
AS3MT Polyclonal Antibody
Product Name : AS3MT Polyclonal AntibodySpecies Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.37 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH 7.3,…
1-Naphthol
Product Name : 1-NaphtholDescription:1-naphthol is an excited state proton transfer (ESPT) fluorescent molecular probe.CAS: 90-15-3Molecular Weight:144.17Formula: C10H8OChemical Name: naphthalen-1-olSmiles : OC1C=CC=C2C=CC=CC2=1InChiKey: KJCVRFUGPWSIIH-UHFFFAOYSA-NInChi : InChI=1S/C10H8O/c11-10-7-3-5-8-4-1-2-6-9(8)10/h1-7,11HPurity: ≥98% (or refer to the Certificate…
ARHGEF7 Polyclonal Antibody, Biotin
Product Name : ARHGEF7 Polyclonal Antibody, BiotinSpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : BiotinForm: LiquidConcentration : 0.5-1.5 mg/mLPurification : Affinity chromatographyStorage buffer: proprietary buffer,…
Crenulatin
Product Name : CrenulatinDescription:Crenulatin is a gallotannin.CAS: 63026-02-8Molecular Weight:248.27Formula: C11H20O6Chemical Name: (2R, 3S, 4S, 5R, 6S)-2-(hydroxymethyl)-6-oxane-3, 4, 5-triolSmiles : CC(C)(C=C)O1O(CO)(O)(O)1OInChiKey: ZEGGZNOPAPRAIG-SPFKKGSWSA-NInChi : InChI=1S/C11H20O6/c1-4-11(2,3)17-10-9(15)8(14)7(13)6(5-12)16-10/h4,6-10,12-15H,1,5H2,2-3H3/t6-,7-,8+,9-,10+/m1/s1Purity: ≥98% (or refer to the Certificate of…
ARHGAP40 Polyclonal Antibody
Product Name : ARHGAP40 Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.2 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH 7.2, with…
ZN-c3
Product Name : ZN-c3Description:ZN-c3 is an orally active, highly potent and selective Wee1 inhibitor (IC50=3.9 nM). ZN-c3 can be used for the research of cancer.CAS: 2376146-48-2Molecular Weight:526.63Formula: C29H34N8O2Chemical Name: (R)-2-allyl-1-(7-ethyl-7-hydroxy-6,…
6x-His Tag Monoclonal Antibody (4E3D10H2/E3), HRP
Product Name : 6x-His Tag Monoclonal Antibody (4E3D10H2/E3), HRPSpecies Reactivity: TagHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: 4E3D10H2/E3Conjugate : HRP View additional formats Alexa Fluor 488 Alexa Fluor 555 Alexa…
MSG606 TFA
Product Name : MSG606 TFADescription:MSG606 TFA is a potent human MC1 receptor antagonist (IC50=17 nM). MSG606 TFA also partial agonist at human MC3 and MC5 receptors (EC50 values are 59…
ANKRA2 Polyclonal Antibody, MaxPab™
Product Name : ANKRA2 Polyclonal Antibody, MaxPab™Species Reactivity: HumanHost/Isotype : Mouse / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer: PBS, pH 7.4Contains : no…
AMG8380
Product Name : AMG8380Description:AMG8380, an orally active and less active enantiomer of AMG8379, can serves as a negative control. AMG8380 inhibits human and mouse voltage-gated sodium channel NaV1.7 with IC50s…
AMPK alpha 1 Polyclonal Antibody
Product Name : AMPK alpha 1 Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.37 mg/mLPurification : Antigen affinity chromatographyStorage buffer:…
Axitinib-d3
Product Name : Axitinib-d3Description:Axitinib-d3 (AG-013736-d3) is deuterium labeled Axitinib. Axitinib is a multi-targeted tyrosine kinase inhibitor with IC50s of 0.1, 0.2, 0.1-0.3, 1.6 nM for VEGFR1, VEGFR2, VEGFR3 and PDGFRβ,…
ALK Monoclonal Antibody (OTI3C8), TrueMAB™
Product Name : ALK Monoclonal Antibody (OTI3C8), TrueMAB™Species Reactivity: HumanHost/Isotype : Mouse / IgG2aClass:MonoclonalType : AntibodyClone: OTI3C8Conjugate : UnconjugatedForm: lyophilizedConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH 7.3,…
β-NF-JQ1
Product Name : β-NF-JQ1Description:β-NF-JQ1 is a PROTAC that recruits AhR E3 ligase to target proteins. β-NF-JQ1 is directed against bromodomain-containing (BRD) proteins using β-NF as an AhR ligand, induces the…
ALK (Anaplastic Lymphoma Kinase)/CD246 Monoclonal Antibody (ALK/1031)
Product Name : ALK (Anaplastic Lymphoma Kinase)/CD246 Monoclonal Antibody (ALK/1031)Species Reactivity: HumanHost/Isotype : Mouse / IgG2b, kappaClass:MonoclonalType : AntibodyClone: ALK/1031Conjugate : UnconjugatedForm: LiquidConcentration : 200 µg/mLPurification : Protein A/GStorage buffer:…
(S, R, S)-AHPC-Me hydrochloride
Product Name : (S, R, S)-AHPC-Me hydrochlorideDescription:(S,R,S)-AHPC-Me hydrochloride (VHL ligand 2 hydrochloride) is the (S,R,S)-AHPC-based VHL ligand used in the recruitment of the von Hippel-Lindau (VHL) protein. (S,R,S)-AHPC-Me hydrochloride can…
AKTIP Polyclonal Antibody
Product Name : AKTIP Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.5 mg/mLPurification : Protein A, Antigen affinity chromatographyStorage buffer: PBS, pH…
Fenoterol hydrobromide
Product Name : Fenoterol hydrobromideDescription:Fenoterol hydrobromide (Th-1165a), a sympathomimetic agent, is a selective and orally active β2-adrenoceptor agonist. Fenoterol hydrobromide is an effective bronchodilator and can be used for bronchospasm…
AKR7A2 Monoclonal Antibody (2E1E8), CoraLite® Plus 488
Product Name : AKR7A2 Monoclonal Antibody (2E1E8), CoraLite® Plus 488Species Reactivity: HumanHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: 2E1E8Conjugate : CoraLite® Plus 488 View additional formats UnconjugatedForm: LiquidConcentration : 1…
β-D-glucuronide-pNP-carbonate
Product Name : β-D-glucuronide-pNP-carbonateDescription:β-D-glucuronide-pNP-carbonate is a cleavable ADC linker used in the synthesis of antibody-drug conjugates (ADCs).CAS: 894095-98-8Molecular Weight:913.83Formula: C45H43N3O18Chemical Name: methyl (2S,3S,4S,5R,6S)-3,4,5-tris(acetyloxy)-6-2-carbonylamino)propanamido]-4-(oxymethyl)phenoxyoxane-2-carboxylateSmiles : COC(=O)1O(OC2=CC=C(COC(=O)OC3C=CC(=CC=3)()=O)C=C2NC(=O)CCNC(=O)OCC2C3=CC=CC=C3C3=CC=CC=C32)(OC(C)=O)(OC(C)=O)1OC(C)=OInChiKey: DMGQNZOORDYDEZ-LELKPENRSA-NInChi : InChI=1S/C45H43N3O18/c1-24(49)61-38-39(62-25(2)50)41(63-26(3)51)43(66-40(38)42(53)58-4)65-36-18-13-27(22-60-45(55)64-29-16-14-28(15-17-29)48(56)57)21-35(36)47-37(52)19-20-46-44(54)59-23-34-32-11-7-5-9-30(32)31-10-6-8-12-33(31)34/h5-18,21,34,38-41,43H,19-20,22-23H2,1-4H3,(H,46,54)(H,47,52)/t38-,39-,40-,41+,43+/m0/s1Purity: ≥98% (or…
AHR Monoclonal Antibody (4MEJJ), eFluor™ 660, eBioscience™
Product Name : AHR Monoclonal Antibody (4MEJJ), eFluor™ 660, eBioscience™Species Reactivity: MouseHost/Isotype : Rat / IgG2a, kappaClass:MonoclonalType : AntibodyClone: 4MEJJConjugate : eFluor™ 660 View additional formats Alexa Fluor 488 PE…
Artemotil
Product Name : ArtemotilDescription:Artemotil (β-Arteether) has antimalarial activity for the treatment of chloroquine-resistant Plasmodium falciparum malaria with an IC50 of 1.61 nM. Artemotil also has central nervous system (CNS) neurotoxicity…
AEBP2 Polyclonal Antibody
Product Name : AEBP2 Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.26 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH…
Thalidomide-NH-amido-PEG1-C2-NH2 hydrochloride
Product Name : Thalidomide-NH-amido-PEG1-C2-NH2 hydrochlorideDescription:Thalidomide-NH-amido-PEG1-C2-NH2 hydrochloride is a synthesized E3 ligase ligand-linker conjugate that incorporates the Thalidomide based cereblon ligand and a linker used in PROTAC technology.CAS: Molecular Weight:453.88Formula: C19H24ClN5O6Chemical…
m-PEG6-NHS ester
Product Name : m-PEG6-NHS esterDescription:m-PEG6-NHS ester is a non-cleavable 6 unit PEG ADC linker used in the synthesis of antibody-drug conjugates (ADCs). m-PEG6-NHS ester is a PEG/Alkyl/ether-based PROTAC linker can…
SCD1 inhibitor-1
Product Name : SCD1 inhibitor-1Description:SCD1 inhibitor-1 is a potent and liver-selective stearoyl-CoA desaturase-1 (SCD1) inhibitor.CAS: 1069094-65-0Molecular Weight:451.54Formula: C21H22N3NaO3S2Chemical Name: sodium 2-methylthiophene-2-amido)-1,3-thiazol-4-yl]acetateSmiles : CCCCC1=CC=CC=C1NCC1=CC=C(S1)C(=O)NC1=NC(CC(=O)O)=CS1InChiKey: XQNBRLFLBSUHOU-UHFFFAOYSA-MInChi : InChI=1S/C21H23N3O3S2.Na/c1-2-3-6-14-7-4-5-8-17(14)22-12-16-9-10-18(29-16)20(27)24-21-23-15(13-28-21)11-19(25)26;/h4-5,7-10,13,22H,2-3,6,11-12H2,1H3,(H,25,26)(H,23,24,27);/q;+1/p-1Purity: ≥98% (or refer to…
Medetomidine Hydrochloride
Product Name : Medetomidine HydrochlorideDescription:Medetomidine, also known as MPV-785, is a synthetic drug used as both a surgical anesthetic and analgesic. It is an alpha-2 adrenergic agonist that can be…
Carbetocin
Product Name : CarbetocinDescription:CarbetocinCAS: 37025-55-1Molecular Weight:988.16Formula: C45H69N11O12SChemical Name: (2S)-2--9-(2-carbamoylethyl)-6-(carbamoylmethyl)-15--5,8,11,14,17-pentaoxo-1-thia-4,7,10,13,16-pentaazacycloicosane-3-carbonyl]pyrrolidin-2-yl]formamido-N-(carbamoylmethyl)-4-methylpentanamideSmiles : CC(C)C(NC(=O)1CCCN1C(=O)1CSCCCC(=O)N(CC2=CC=C(C=C2)OC)C(=O)N((C)CC)C(=O)N(CCC(N)=O)C(=O)N(CC(N)=O)C(=O)N1)C(=O)NCC(N)=OInChiKey: NSTRIRCPWQHTIA-DTRKZRJBSA-NInChi : InChI=1S/C45H69N11O12S/c1-6-25(4)38-44(66)51-28(15-16-34(46)57)40(62)52-31(21-35(47)58)41(63)54-32(23-69-18-8-10-37(60)50-30(42(64)55-38)20-26-11-13-27(68-5)14-12-26)45(67)56-17-7-9-33(56)43(65)53-29(19-24(2)3)39(61)49-22-36(48)59/h11-14,24-25,28-33,38H,6-10,15-23H2,1-5H3,(H2,46,57)(H2,47,58)(H2,48,59)(H,49,61)(H,50,60)(H,51,66)(H,52,62)(H,53,65)(H,54,63)(H,55,64)/t25-,28-,29-,30-,31-,32-,33-,38-/m0/s1Purity: ≥98% (or refer to the Certificate of Analysis)Shipping Condition: Shipped under ambient temperature as non-hazardous chemical…
Ubiquitin, (agarose immobilized)
Product Name : Ubiquitin, (agarose immobilized)Sequence: Purity: Molecular Weight:Solubility : Appearance: Use/Stability : As indicated on product label or CoA when stored as recommended.Description: CAS : Solubility: Formula: Additional Information…
Tetrazolium Red
Product Name : Tetrazolium RedDescription:DMOG, also known as Dimethyloxaloylglycine, is a cell permeable, competitive inhibitor of HIF-PH. It acts to stabilize HIF-1α expression at normal oxygen tensions in cultured cells,…
TLCK
Product Name : TLCKSequence: Na-Tosyl-Lys-chloromethylketonePurity: ≥95% (HPLC)Molecular Weight:369.3Solubility : Soluble in methanol (50mg/ml), DMSO (5mM) or water. Stock solutions at concentrations up to 10mM can be prepared in aqueous buffers…
NADPH tetrasodium salt
Product Name : NADPH tetrasodium saltDescription:NADPH tetrasodium salt is a cofactor, used to donate electrons and a hydrogens to reactions catalyzed by some enzymes.CAS: 2646-71-1Molecular Weight:833.35Formula: C21H26N7Na4O17P3Chemical Name: methyl sodium…
Somatostatin polyclonal antibody
Product Name : Somatostatin polyclonal antibodySequence: Purity: Molecular Weight:Solubility : Appearance: Use/Stability : Dilute to working strength with 50mM PBS (pH 7.4) containing 1.5% sodium chloride and 1% normal goat…
Hederacolchiside A1
Product Name : Hederacolchiside A1Description:Hederacolchiside A1, isolated from Pulsatilla chinensis, suppresses proliferation of tumor cells by inducing apoptosis through modulating PI3K/Akt/mTOR signaling pathway. Hederacolchiside A1 has antischistosomal activity, affecting parasite…
SEEBRIGHT® Gold 525 dUTP (lyophilized)
Product Name : SEEBRIGHT® Gold 525 dUTP (lyophilized)Sequence: Purity: ≥93% (HPLC)Molecular Weight:Solubility : Appearance: Magenta solid.Use/Stability : As indicated on product label or CoA when stored as recommended. Stable for…
Proteasome inhibitor I (aldehyde)
Product Name : Proteasome inhibitor I (aldehyde)Sequence: Z-Ile-Glu(OtBu)-Ala-Leu-CHOPurity: ≥95% (TLC)Molecular Weight:618.8Solubility : Soluble in 100% ethanol (30mg/ml), DMSO (30mg/ml) or methanol (50mg/ml).Appearance: White powder.Use/Stability : As indicated on product label or…
Benzbromarone
Product Name : BenzbromaroneDescription:Benzbromarone is a highly effective and well tolerated non-competitive inhibitor of xanthine oxidase, used as an uricosuric agent, used in the treatment of gout.CAS: 3562-84-3Molecular Weight:424.08Formula: C17H12Br2O3Chemical…
PKA kinase activity kit
Product Name : PKA kinase activity kitSequence: Purity: Molecular Weight:Solubility : Appearance: Use/Stability : Store all components at 4°C, except active kinase at -80°C.Description: Non-radioactive protein kinase assay provides rapid…
p53 (wild type) (human), (recombinant)
Product Name : p53 (wild type) (human), (recombinant)Sequence: Purity: ≥90% (SDS-PAGE)Molecular Weight:~82kDa (including GST-tag)Solubility : Appearance: Use/Stability : Description: The p53 protein is a transcription factor that plays a crucial…
(R)-Amlodipine-d4
Product Name : (R)-Amlodipine-d4Description:Product informationCAS: 1346616-97-4Molecular Weight:412.90Formula: C20H25ClN2O5Chemical Name: 3-ethyl 5-methyl (4S)-2-{methyl}-4-(2-chlorophenyl)-6-methyl-1,4-dihydropyridine-3,5-dicarboxylateSmiles : C()(OCC1NC(C)=C((C=1C(=O)OCC)C1=CC=CC=C1Cl)C(=O)OC)C()()NInChiKey: HTIQEAQVCYTUBX-MIHJCSFKSA-NInChi : InChI=1S/C20H25ClN2O5/c1-4-28-20(25)18-15(11-27-10-9-22)23-12(2)16(19(24)26-3)17(18)13-7-5-6-8-14(13)21/h5-8,17,23H,4,9-11,22H2,1-3H3/t17-/m0/s1/i9D2,10D2Purity: ≥98% (or refer to the Certificate of Analysis)Shipping Condition: Shipped under ambient temperature…
NUCLEAR-ID® Red cell cycle kit (GFP-CERTIFIED®)
Product Name : NUCLEAR-ID® Red cell cycle kit (GFP-CERTIFIED®)Sequence: Purity: Molecular Weight:Solubility : Appearance: Use/Stability : With proper storage, the kit components are stable up to the date noted on…
NEDD8 polyclonal antibody
Product Name : NEDD8 polyclonal antibodySequence: Purity: Molecular Weight:Solubility : Appearance: Use/Stability : Description: CAS : Solubility: Formula: Additional Information : | Alternative Name Neddylin, Neural precursor cell expressed developmentally…
N-Methyl-N-(trimethylsilyl)trifluoroacetamide-d9
Product Name : N-Methyl-N-(trimethylsilyl)trifluoroacetamide-d9Description:Product informationCAS: 945623-67-6Molecular Weight:208.30Formula: C6H12F3NOSiChemical Name: 2,2,2-trifluoro-N-methyl-N-acetamideSmiles : C()()(N(C)C(=O)C(F)(F)F)(C()())C()()InChiKey: MSPCIZMDDUQPGJ-WVZRYRIDSA-NInChi : InChI=1S/C6H12F3NOSi/c1-10(12(2,3)4)5(11)6(7,8)9/h1-4H3/i2D3,3D3,4D3Purity: ≥98% (or refer to the Certificate of Analysis)Shipping Condition: Shipped under ambient temperature as non-hazardous…
MEK5 polyclonal antibody
Product Name : MEK5 polyclonal antibodySequence: Purity: Molecular Weight:Solubility : Appearance: Use/Stability : Description: MEK is a dual specificity kinase capable of phosphorylating both tyrosine and threonine residues. The MEK…
LAG-3 (human) recombinant monoclonal antibody (L4-PL33)
Product Name : LAG-3 (human) recombinant monoclonal antibody (L4-PL33)Sequence: Purity: Molecular Weight:Solubility : Appearance: Use/Stability : Stable for at least 6 months after receipt when stored as recommended.Description: The lymphocyte…
Meseclazone
Product Name : MeseclazoneDescription:Meseclazone (W2395;NSC297623) exhibits inhibitory potency of secondary phase ADP aggregation. Meseclazone possesses anti-inflammatory, analgesic and antipyretic activity.CAS: 29053-27-8Molecular Weight:239.66Formula: C11H10ClNO3Chemical Name: 11-chloro-5-methyl-2,6-dioxa-7-azatricyclotrideca-1(13),9,11-trien-8-oneSmiles : CC1CC2OC3=CC=C(Cl)C=C3C(=O)N2O1InChiKey: OJGJQQNLRVNIKE-UHFFFAOYSA-NInChi : InChI=1S/C11H10ClNO3/c1-6-4-10-13(16-6)11(14)8-5-7(12)2-3-9(8)15-10/h2-3,5-6,10H,4H2,1H3Purity:…
Immunoproteasome 20S (human), (purified)
Product Name : Immunoproteasome 20S (human), (purified)Sequence: Purity: Molecular Weight:Solubility : Appearance: Use/Stability : As indicated on product label or CoA when stored as recommended. Once thawed the material can…
IL-1β (human), (recombinant) (cell culture grade)
Product Name : IL-1β (human), (recombinant) (cell culture grade)Sequence: Purity: ≥97% (SDS-PAGE)Molecular Weight:~17kDa.Solubility : Appearance: Use/Stability : Description: Potent immunomodulator Potent immunomodulator. Mediates a wide range of immune and inflammatory…
PHT-7.3
Product Name : PHT-7.3Description:PHT-7.3 is a selective inhibitor of connector enhancer of kinase suppressor of Ras 1 (Cnk1) pleckstrin homology (PH) domain (Kd=4.7 μM). PHT-7.3 inhibits mut-KRas, but not wild-type…
C-Reactive Protein (CRP) (201-206)
Product Name : C-Reactive Protein (CRP) (201-206)Description:C-Reactive Protein (CRP) 201-206 is the 201-206 fragment of C-Reactive Protein. C-Reactive Protein (CRP), the prototypic marker of inflammation, is a cardiovascular risk marker…
Pyropheophorbide-a
Product Name : Pyropheophorbide-aDescription:Pyropheophorbide-a (Ppa) is a promising photosensitizer for tumor photodynamic therapy (PDT).CAS: 24533-72-0Molecular Weight:534.65Formula: C33H34N4O3Chemical Name: 3-hexacosa-1,4,6,8(26),9,11,13(25),14,16,18(24),19-undecaen-22-yl]propanoic acidSmiles : C1(CCC(O)=O)C2NC1=CC1=NC(=CC3=NC(=CC4N=C5C(=C(O)CC5=2)C=4C)C(CC)=C3C)C(C=C)=C1CInChiKey: FDKRLXBXYZKWRZ-HASICPNOSA-NInChi : InChI=1S/C33H34N4O3/c1-7-19-15(3)23-12-25-17(5)21(9-10-30(39)40)32(36-25)22-11-29(38)31-18(6)26(37-33(22)31)14-28-20(8-2)16(4)24(35-28)13-27(19)34-23/h7,12-14,17,21,36,38H,1,8-11H2,2-6H3,(H,39,40)/b25-12-,27-13-,28-14-,32-22-/t17-,21-/m0/s1Purity: ≥98% (or refer to the…
CUG
Product Name : CUGDescription:CUG (3-Carboxyumbelliferyl-β-D-galactopyranoside) is a fluorogenic substrate (λex=386, λem=445 nm, ε=32K).CAS: 64664-99-9Molecular Weight:368.29Formula: C16H16O10Chemical Name: 2-oxo-7-{oxy}-2H-chromene-3-carboxylic acidSmiles : OC(=O)C1=CC2=CC=C(C=C2OC1=O)O1O(CO)(O)(O)1OInChiKey: HGMXXIAQZWTZLR-WUGLTUCPSA-NInChi : InChI=1S/C16H16O10/c17-5-10-11(18)12(19)13(20)16(26-10)24-7-2-1-6-3-8(14(21)22)15(23)25-9(6)4-7/h1-4,10-13,16-20H,5H2,(H,21,22)/t10-,11+,12+,13-,16-/m1/s1Purity: ≥98% (or refer to the Certificate…
L-(+)-Arabinose
Product Name : L-(+)-ArabinoseSynonym: NSC 1941CAS : 5328-37-0Molecular formula:C5H10O5Molecular Weight : 150.13Purity: ≥99% (HPLC)Specifications: Purity ≥99% (HPLC)|Appearance White to off-white powder|Identity 1H-NMR|PropertiesSolvents water|Melting Point 160-163 °C(lit.{{989-51-5} medchemexpress|{989-51-5} Technical Information|{989-51-5} In…
Amino-PEG10-amine
Product Name : Amino-PEG10-amineDescription:Amino-PEG10-amine, a PEG-based PROTAC linker used to combine two mono diethylstilbestrol (DES)-based ligands, provides an alternative strategy for preparing more selective and active ER antagonists for endocrine…
Fluorescein dibutyrate
Product Name : Fluorescein dibutyrateSynonym: CAS : 7298-65-9Molecular formula:C28H24O7Molecular Weight : 472.{{129453-61-8} MedChemExpress|{129453-61-8} Biological Activity|{129453-61-8} In Vitro|{129453-61-8} supplier} 49Purity: ≥98% (HPLC)Specifications: Purity ≥98% (HPLC)|Appearance Off-white powder|Identity 1H-NMR|PropertiesSolvents DMSO, DMF, chloroform|Melting…
Diclofop
Product Name : DiclofopSynonym: 2-(4-(2,4-Dichlorophenoxy)phenoxy)propionic acid , HOE-021079CAS : 40843-25-2Molecular formula:C15H12Cl2O4Molecular Weight : 327.{{76410-58-7} medchemexpress|{76410-58-7} Biological Activity|{76410-58-7} Purity|{76410-58-7} manufacturer} 2Purity: ≥98% (HPLC)Specifications: Purity ≥98% (HPLC)|Appearance White solid|Identity 1H-NMR|PropertiesSolvents chloroform|{{2573775-59-2} medchemexpress|{2573775-59-2}…
DAR-MT solution (5 mM in DMSO), 1 mg in 0.40 ml DMSO
Product Name : DAR-MT solution (5 mM in DMSO), 1 mg in 0.40 ml DMSOSynonym: Diaminorhodamine-M triazole , 3,6-Bis(diethylamino)-9-(4-carboxy-1-methylbenzotriazol-5-yl)xanthylium intramolecular saltCAS : 261351-47-7Molecular formula:C29H31N5O3Molecular Weight : 497.{{1228538-47-3} MedChemExpress|{1228538-47-3} Purity &…
Vicenin 2
Product Name : Vicenin 2Description:Vicenin 2 is an angiotensin-converting enzyme (ACE) inhibitor (IC50=43.83 μM) from the aerial parts of Desmodium styracifolium.CAS: 23666-13-9Molecular Weight:594.52Formula: C27H30O15Chemical Name: 5,7-dihydroxy-2-(4-hydroxyphenyl)-6,8-bis-4H-chromen-4-oneSmiles : OC1C=CC(=CC=1)C1=CC(=O)C2=C(O1)C(1O(CO)(O)(O)1O)=C(O)C(1O(CO)(O)(O)1O)=C2OInChiKey: FIAAVMJLAGNUKW-VQVVXJKKSA-NInChi :…
2″-O-Galloylhyperin
Product Name : 2"-O-GalloylhyperinDescription:2"-O-Galloylhyperin, an active compound isolated from Pyrola incarnate Fisch., possesses anti-oxidative and anti-inflammatory activities. 2"-O-Galloylhyperin has hepatoprotective effect against oxidative stress-induced liver damage.CAS: 53209-27-1Molecular Weight:616.48Formula: C28H24O16Chemical Name:…
1,1′-(1,2-Ethanediyl)bis-1H-1,2,4-triazole
Product Name : 1,1′-(1,2-Ethanediyl)bis-1H-1,2,4-triazoleSynonym: CAS : 116476-98-3Molecular formula:C6H8N6Molecular Weight : 164.{{404-86-4} site|{404-86-4} Technical Information|{404-86-4} In Vivo|{404-86-4} custom synthesis} 17Purity: ≥97% (HPLC)Specifications: Purity ≥97% (HPLC)|Appearance Solid|Identity 1H-NMR|PropertiesSolvents chloroform|{{1439399-58-2} MedChemExpress|{1439399-58-2} Technical Information|{1439399-58-2}…
(±)-Lisofylline
Product Name : (±)-LisofyllineSynonym: 1-(5'-Hydroxyhexyl)-3,7-dimethylxanthine , LSF , BL 194 , CT-1501R , 5-Hydroxy pentoxifyllineCAS : 6493-06-7Molecular formula:C13H20N4O3Molecular Weight : 280.3Purity: ≥99% (HPLC)Specifications: Purity ≥99% (HPLC)|Appearance White powder|Identity 1H-NMR|PropertiesSolvents chloroform|DownloadsSafety…
Neridronate
Product Name : NeridronateDescription:Neridronate is an aminobisphosphonate, licensed in Italy for the treatment of osteogenesis imperfecta (OI) and Paget’s disease of bone (PDB). Neridronate is effective also in other skeletal…
Angeloylgomisin H
Product Name : Angeloylgomisin HDescription:Angeloylgomisin H, as a major lignin extract of Schisandra rubriflora, has the potential to improve insulin-stimulated glucose uptake by activating PPAR-γ.CAS: 66056-22-2Molecular Weight:500.58Formula: C28H36O8Chemical Name: (9S,10S)-10-hydroxy-4,5,14,15,16-pentamethoxy-9,10-dimethyltricyclohexadeca-1(16),2,4,6,12,14-hexaen-3-yl…
6RK73
Product Name : 6RK73Description:6RK73 is a covalent irreversible and specific UCHL1 inhibitor with an IC50 of 0.23 µM. 6RK73 shows almost no inhibition of UCHL3 (IC50=236 µM). 6RK73 specifically inhibit…
MBP Nanoselector Agarose
Product Name : MBP Nanoselector AgaroseApplications: IP,CHIP,MS,PurificationReactivity : MBPConjugate:AgaroseAdvantages : · Consistent and reproducible results· No heavy & light antibody chains · Extraordinary binding, even under harsh conditions· High affinity…
Jagged-1 (188-204) (TFA)
Product Name : Jagged-1 (188-204) (TFA)Description:Jagged-1 (188-204) TFA is a fragment of the Jagged-1 (JAG-1) protein. JAG-1 is a Notch ligand highly expressed in cultured and primary multiple myeloma (MM)…
L(+)-Arabinose
Product Name : L(+)-ArabinoseCAS No.: 87-72-9Purity : > 98%Shipping:Shipped on dry ice.Storage : Powder: -20 °C, 3 years; 4 °C, 2 yearsIn solvent: -80 °C, 6 months; -20 °C, 1…
Anti-Mouse IgG3(Fcγ Fragment specific), AlpSdAbs® VHH(iFluor594)
Product Name : Anti-Mouse IgG3(Fcγ Fragment specific), AlpSdAbs® VHH(iFluor594)Applications: WB,ICC/IF,ELISA,Flow CytReactivity : Mouse IgG3(Fcγ Fragment specific)Conjugate:iFluor594Advantages : High lot-to-lot consistencyIncreased sensitivity and higher affinityAnimal-free productionDescription: | Description: Anti-Mouse IgG3(Fcγ Fragment…
NCC007
Product Name : NCC007Description:NCC007 is a dual casein kinase Iα (CKIα) and δ (CKIδ) inhibitor with IC50s of 1.8 and 3.6 μM, respectively. NCC007 can be used in research of…
Anti-PDL1/CD274(Durvalumab Biosimilar) Antibody
Product Name : Anti-PDL1/CD274(Durvalumab Biosimilar) AntibodyApplications: ELISA,Flow CytReactivity : Human PDL1/CD274Conjugate:UnconjugatedAdvantages : High lot-to-lot consistencyIncreased sensitivity and higher affinityAnimal-free productionDescription: | Description: Anti-PDL1/CD274(Durvalumab Biosimilar) Antibody is a biosimilar antibody directed…
Anti-IL4R/CD124(Rademikibart Biosimilar) Antibody
Product Name : Anti-IL4R/CD124(Rademikibart Biosimilar) AntibodyApplications: ELISA,Flow CytReactivity : Human IL4R/CD124Conjugate:UnconjugatedAdvantages : High lot-to-lot consistencyIncreased sensitivity and higher affinityAnimal-free productionDescription: | Description: Anti-IL4R/CD124(Rademikibart Biosimilar) Antibody is a biosimilar antibody directed…
trans-Abacavir-d4 hydrochloride
Product Name : trans-Abacavir-d4 hydrochlorideDescription:Product informationCAS: 1346605-40-0Molecular Weight:326.82Formula: C14H19ClN6OChemical Name: amino}-9H-purin-9-yl)cyclopent-2-en-1-yl]methanol hydrochlorideSmiles : Cl.C1()C(NC2=NC(N)=NC3=C2N=CN32C(CO)C=C2)C1()InChiKey: QXNOPHSMRJNHHG-CRUONMBASA-NInChi : InChI=1S/C14H18N6O.ClH/c15-14-18-12(17-9-2-3-9)11-13(19-14)20(7-16-11)10-4-1-8(5-10)6-21;/h1,4,7-10,21H,2-3,5-6H2,(H3,15,17,18,19);1H/t8-,10-;/m0./s1/i2D2,3D2;Purity: ≥98% (or refer to the Certificate of Analysis)Shipping Condition: Shipped under ambient temperature…
Anti-GREM1(Ginisortamab Biosimilar) Antibody
Product Name : Anti-GREM1(Ginisortamab Biosimilar) AntibodyApplications: ELISA,Flow CytReactivity : Human GREM1Conjugate:UnconjugatedAdvantages : High lot-to-lot consistencyIncreased sensitivity and higher affinityAnimal-free productionDescription: | Description: Anti-GREM1(Ginisortamab Biosimilar) Antibody is a biosimilar antibody directed…
Anti-HA tag, AlpSdAbs® VHH(iFluor488)
Product Name : Anti-HA tag, AlpSdAbs® VHH(iFluor488)Applications: WB,ICC/IF,ELISA,Flow CytReactivity : HA tagConjugate:iFluor488Advantages : High lot-to-lot consistencyIncreased sensitivity and higher affinityAnimal-free productionDescription: | Description: Anti-HA tag, AlpSdAbs® VHH(iFluor488) is designed for…
rac-N-Benzyl Nebivolol-d4
Product Name : rac-N-Benzyl Nebivolol-d4Description:Product informationCAS: 1246814-48-1Molecular Weight:499.58Formula: C29H31F2NO4Chemical Name: 2-{benzylamino}-1-(6-fluoro-3,4-dihydro-2H-1-benzopyran-2-yl)(2,2-²H₂)ethan-1-olSmiles : C()(C(O)C1CCC2=CC(F)=CC=C2O1)N(CC1C=CC=CC=1)C()()C(O)C1CCC2=CC(F)=CC=C2O1InChiKey: STEPXTPIBUXRLE-DBTGQBASSA-NInChi : InChI=1S/C29H31F2NO4/c30-22-8-12-26-20(14-22)6-10-28(35-26)24(33)17-32(16-19-4-2-1-3-5-19)18-25(34)29-11-7-21-15-23(31)9-13-27(21)36-29/h1-5,8-9,12-15,24-25,28-29,33-34H,6-7,10-11,16-18H2/i17D2,18D2Purity: ≥98% (or refer to the Certificate of Analysis)Shipping Condition: Shipped under ambient temperature as…
21-Acetoxypregna-1, 4, 9(11), 16-tetraene-3, 20-dione
Product Name : 21-Acetoxypregna-1, 4, 9(11), 16-tetraene-3, 20-dioneDescription:21-Acetoxypregna-1,4,9(11),16-tetraene-3,20-dione is an intermediate of delta 9,11 steroids synthesis, for example, Vamorolone (HY-109017). The delta 9,11 steroids are modifications of glucocorticoids and has…
Anti-Human NCL, AlpSdAbs® VHH
Product Name : Anti-Human NCL, AlpSdAbs® VHHApplications: ELISA,Flow Cyt,IF,SPR,WBReactivity : Human NCLConjugate:UnconjugatedAdvantages : High lot-to-lot consistencyAnimal-free productionDescription: | Description: Anti-Human NCL, AlpSdAbs® VHH is designed for detecting Human NCL, and…
Anti-VHH, Rabbit antibody(iFluor594)
Product Name : Anti-VHH, Rabbit antibody(iFluor594)Applications: WB,ELISA,Flow CytReactivity : VHHConjugate:iFluor594Advantages : High lot-to-lot consistencyIncreased sensitivity and higher affinityAnimal-free productionDescription: | Description: Anti-VHH, Rabbit antibody(iFluor594) is designed for detecting camelid VHH…
4-Aza-Oleanolic acid methyl ester
Product Name : 4-Aza-Oleanolic acid methyl esterDescription:4-Aza-Oleanolic acid methyl ester is a triterpenic derivative.CAS: 557766-15-1Molecular Weight:441.65Formula: C28H43NO3Chemical Name: methyl (6aR,6bS,8aS,14bR)-6a,6b,11,11,14b-pentamethyl-3-oxo-1H,2H,3H,4H,4aH,5H,6H,6aH,6bH,7H,8H,8aH,9H,10H,11H,12H,12aH,14H,14aH,14bH-phenanthroquinoline-8a-carboxylateSmiles : CC1(C)CC2C3=CCC45(C)CCC(=O)NC5CC4(C)3(C)CC2(CC1)C(=O)OCInChiKey: NACWCFADSOSVKU-BPKKCFKCSA-NInChi : InChI=1S/C28H43NO3/c1-24(2)13-15-28(23(31)32-6)16-14-26(4)18(19(28)17-24)7-8-20-25(3)11-10-22(30)29-21(25)9-12-27(20,26)5/h7,19-21H,8-17H2,1-6H3,(H,29,30)/t19?,20?,21?,25-,26-,27-,28+/m1/s1Purity: ≥98% (or refer to the…
Anti-Human IgG(CH2 Fragment specific), Mouse antibody(Biotin)
Product Name : Anti-Human IgG(CH2 Fragment specific), Mouse antibody(Biotin)Applications: IP,WB,ELISAReactivity : Human IgGConjugate:BiotinAdvantages : High lot-to-lot consistencyIncreased sensitivity and higher affinityAnimal-free productionDescription: | Description: Anti-Human IgG(CH2 Fragment specific), Mouse antibody(Biotin)…
Anti-CD40/TNFRSF5(Lucatumumab Biosimilar) Antibody
Product Name : Anti-CD40/TNFRSF5(Lucatumumab Biosimilar) AntibodyApplications: ELISA,Flow CytReactivity : Human TNFRSF5/CD40Conjugate:UnconjugatedAdvantages : High lot-to-lot consistencyIncreased sensitivity and higher affinityAnimal-free productionDescription: | Description: Anti-CD40/TNFRSF5(Lucatumumab Biosimilar) Antibody is a biosimilar antibody directed…
Anti-MUC16, Human antibody
Product Name : Anti-MUC16, Human antibodyApplications: ELISA,Flow CytReactivity : HumanConjugate:UnconjugatedAdvantages : High lot-to-lot consistencyIncreased sensitivity and higher affinityAnimal-free productionDescription: | Description: Anti-MUC16, Human antibody is designed for detecting human MUC16…
Methylophiopogonanone A
Product Name : Methylophiopogonanone ADescription:Methylophiopogonanone A, a major homoisoflavonoid in Ophiopogon japonicas, has both anti-oxidative and anti-inflammatory properties.CAS: 74805-92-8Molecular Weight:342.34Formula: C19H18O6Chemical Name: (3R)-3--5,7-dihydroxy-6,8-dimethyl-3,4-dihydro-2H-1-benzopyran-4-oneSmiles : CC1C2OC(CC3C=C4OCOC4=CC=3)C(=O)C=2C(O)=C(C)C=1OInChiKey: BXTNNJIQILYHJB-GFCCVEGCSA-NInChi : InChI=1S/C19H18O6/c1-9-16(20)10(2)19-15(17(9)21)18(22)12(7-23-19)5-11-3-4-13-14(6-11)25-8-24-13/h3-4,6,12,20-21H,5,7-8H2,1-2H3/t12-/m1/s1Purity: ≥98% (or…
GOAT-IN-1
Product Name : GOAT-IN-1CAS No.: 1452473-54-9Purity : > 99%Shipping:Shipped on dry ice.Storage : Protect from light.Powder: -80 °C, 2 years; -20 °C, 1 year.In solvent: -80 °C, 6 months; -20…
Furazolidone
Product Name : FurazolidoneCAS No.: 67-45-8Purity : > 98%Shipping:Shipped on dry ice.Storage : Store at -20 °C.{{2101700-15-4} site|{2101700-15-4} Protocol|{2101700-15-4} Purity|{2101700-15-4} manufacturer} Store In the Dark.SMILES: C1COC(=O)N1N=CC2=CC=C(O2)(=O)Product Description : Antibacterial nitrofuran…
I-OMe-Tyrphostin AG 538
Product Name : I-OMe-Tyrphostin AG 538Description:I-OMe-Tyrphostin AG 538 (I-OMe-AG 538) is a specific inhibitor of IGF-1R (insulin-like growth factor-1 receptor tyrosine kinase). I-OMe-Tyrphostin AG 538 inhibits IGF-1R-mediated signaling and is…
Cinnamaldehyde
Product Name : CinnamaldehydeCAS No.: 14371-10-9Purity : > 99%Shipping:Shipped on dry ice.Storage : Powder: -20 °C, 3 years; 4 °C, 2 yearsIn solvent: -80 °C, 6 months; -20 °C, 1…
Cediranib Maleate
Product Name : Cediranib MaleateCAS No.: 857036-77-2Purity : > 99%Shipping:Shipped on dry ice.Storage : Powder: -20 °C, 3 years; 4 °C, 2 yearsIn solvent: -80 °C, 6 months; -20 °C,…
Bezafibrate
Product Name : BezafibrateCAS No.: 41859-67-0Purity : > 99%Shipping:Shipped on dry ice.Storage : Store at Room Temperature. The product can be stored for up to 12 months.SMILES: O=C(NCCc1ccc(OC(C)(C)C(=O)O)cc1)c2ccc(Cl)cc2Product Description :…
Contezolid
Product Name : ContezolidDescription:Contezolid (MRX-I), a new and oraly active oxazolidinone, is an antibiotic in study for complicated skin and soft tissue infections (cSSTI) caused by resistant Gram-positive bacteria. Contezolid…
AR453588 hydrochloride
Product Name : AR453588 hydrochlorideCAS No.: 1065606-97-4Purity : Shipping:Room temperature in the continental U.S. Other areas may vary.Storage : Please store the product under the recommended conditions in the Certificate…
Z-Ala-Val-OH
Product Name : Z-Ala-Val-OHSynonym : Chemical Name : CAS NO.: 14550-79-9Molecular formula : C16H22N2O5Molecular Weight: 322.36 g/molClassification : MedChemExpress Products > Research Chemicals > Z-Ala-Val-OHDescription: Z-Ala-Val-OH is a prodrug that…
Gly-Pro
Product Name : Gly-ProSynonym : Chemical Name : CAS NO.: 704-15-4Molecular formula : C7H12N2O3Molecular Weight: 172.18 g/molClassification : MedChemExpress Products > Life Sciences > Gly-ProDescription: Gly-Pro is a cyclic peptide…
Mcl-1 antagonist 1
Product Name : Mcl-1 antagonist 1Synonym : Chemical Name : CAS NO.: 2376775-05-0Molecular formula : C41H54ClF2N5O8SMolecular Weight: 850.4 g/molClassification : MedChemExpress Products > Life Sciences > Mcl-1 antagonist 1Description: Mcl-1…
Oleyloxyethyl Phosphorylcholine
Product Name : Oleyloxyethyl PhosphorylcholineDescription:IC50: 6.2 μM for porcine pancreatic PLA2 Oleyloxyethyl phosphorylcholine is a PLA2 inhibitor. Phospholipases A2 (PLA2s) are enzymes releasing fatty acids from glycerol. This particular phospholipase…
Alcohol Oxidase – vacuum-dried powder, >0.6 units/mg solid
Product Name : Alcohol Oxidase - vacuum-dried powder, >0.6 units/mg solidSynonym : Chemical Name : CAS NO.: 9073-63-6Molecular formula : Molecular Weight: Classification : MedChemExpress Products > Enzymes > Alcohol…
PHA 568487
Product Name : PHA 568487Synonym : Chemical Name : CAS NO.: 527680-57-5Molecular formula : C20H24N2O7Molecular Weight: 404.41 g/molClassification : MedChemExpress Products > Research Chemicals > PHA 568487Description: PHA 568487 is…
MEDICA 16
Product Name : MEDICA 16Synonym : Chemical Name : CAS NO.: 87272-20-6Molecular formula : C20H38O4Molecular Weight: 342.51 g/molClassification : MedChemExpress Products > Research Chemicals > MEDICA 16Description: MEDICA 16 is…
CM-4620
Product Name : CM-4620Synonym : Chemical Name : CAS NO.: 1713240-67-5Molecular formula : C19H11ClF3N3O3Molecular Weight: 421.76 g/molClassification : MedChemExpress Products > Life Sciences > CM-4620Description: CM-4620 is a small molecule…
Ibalizumab
Product Name : IbalizumabSynonym : Chemical Name : CAS NO.: 680188-33-4Molecular formula : Molecular Weight: Classification : MedChemExpress Products > Life Sciences > Antibodies > Monoclonal Antibodies > IbalizumabDescription: Anti-Human…
Secoisolariciresinol monoglucoside
Product Name : Secoisolariciresinol monoglucosideSynonym : Chemical Name : CAS NO.: 63320-67-2Molecular formula : C26H36O11Molecular Weight: 524.6 g/molClassification : MedChemExpress Products > Natural Products > Secoisolariciresinol monoglucosideDescription: Secoisolariciresinol monoglucoside is…
AL 8810 isopropyl ester
Product Name : AL 8810 isopropyl esterDescription:EC50: 430 nM AL 8810 is a a FP receptor antagonist. Prostaglandin F receptor (FP), a receptor belonging to the prostaglandin (PG) group of…
ND-630
Product Name : ND-630Synonym : FirsocostatChemical Name : CAS NO.: 1434635-54-7Molecular formula : C28H31N3O8SMolecular Weight: 569.63 g/molClassification : MedChemExpress Products > Life Sciences > ND-630Description: ND-630 is a drug that…
Eupalinolide H
Product Name : Eupalinolide HSynonym : Chemical Name : CAS NO.: 1402067-83-7Molecular formula : C22H28O8Molecular Weight: 420.5 g/molClassification : MedChemExpress Products > Natural Products > Eupalinolide HDescription: Eupalinolide H is…
TAS-114
Product Name : TAS-114Synonym : Chemical Name : CAS NO.: 1198221-21-4Molecular formula : C21H29N3O6SMolecular Weight: 451.5 g/molClassification : MedChemExpress Products > Life Sciences > Ligands > TAS-114Description: TAS-114 is a…
SKF 97541
Product Name : SKF 97541Description:Product informationCAS: 127729-35-5Molecular Weight:137.12Formula: C4H12NO2PChemical Name: (3-aminopropyl)(methyl)phosphinic acidSmiles : C(O)(=O)CCCNInChiKey: NHVRIDDXGZPJTJ-UHFFFAOYSA-NInChi : InChI=1S/C4H12NO2P/c1-8(6,7)4-2-3-5/h2-5H2,1H3,(H,6,7)Purity: ≥98% (or refer to the Certificate of Analysis)Shipping Condition: Shipped under ambient temperature…
Sarsapogenin
Product Name : SarsapogeninSynonym : Chemical Name : CAS NO.: 126-19-2Molecular formula : C27H44O3Molecular Weight: 416.64 g/molClassification : MedChemExpress Products > Natural Products > SarsapogeninDescription: Sarsapogenin is a natural compound…
1-Dehydroxy-23-deoxojessic acid
Product Name : 1-Dehydroxy-23-deoxojessic acidSynonym : Chemical Name : CAS NO.: 149252-87-9Molecular formula : C31H50O3Molecular Weight: 470.7 g/molClassification : MedChemExpress Products > Natural Products > 1-Dehydroxy-23-deoxojessic acidDescription: 1-Dehydroxy-23-deoxojessic acid is…
Meclofenamic acid
Product Name : Meclofenamic acidSynonym : 2-benzoic acidN-(2,6-Dichloro-m-tolyl)anthranilic acidChemical Name : CAS NO.: 644-62-2Molecular formula : C14H11Cl2NO2Molecular Weight: 296.15 g/molClassification : MedChemExpress Products > Research Chemicals > Meclofenamic acidDescription: Meclofenamic…
Hetacillin
Product Name : HetacillinDescription:Hetacillin is a beta-lactam antibiotic that is part of the aminopenicillin family. It is a prodrug and it has no antibacterial activity itself, but quickly splits of…
Ivermectin impurity I
Product Name : Ivermectin impurity ISynonym : (2,3-Didehydro-5-O-demethyl-3,4,22,23-tetrahydro avermectin A1a (Ä2,3H2B1a)Chemical Name : CAS NO.: 1135339-49-9Molecular formula : C48H74O14Molecular Weight: 875.09 g/molClassification : MedChemExpress Products > Impurities > iVermectin >…
L-Arginine
Product Name : L-ArginineSynonym : Chemical Name : CAS NO.: 74-79-3Molecular formula : C6H14N4O2Molecular Weight: 174.2 g/molClassification : MedChemExpress Products > Research Chemicals >Fine Chemicals > L-ArginineDescription: L-Arginine is a…
Corymbiferin
Product Name : CorymbiferinSynonym : Chemical Name : CAS NO.: 5042-09-1Molecular formula : C15H12O7Molecular Weight: 304.25 g/molClassification : MedChemExpress Products > Natural Products > CorymbiferinDescription: Corymbiferin is a natural compound…
Flucloxacillin sodium
Product Name : Flucloxacillin sodiumDescription:Flucloxacillin sodium is a highly active antibiotic against Gram-positive and Gram-negative bacteria.CAS: 1847-24-1Molecular Weight:475.85Formula: C19H16ClFN3NaO5SChemical Name: sodium (2S,5R,6R)-6--3,3-dimethyl-7-oxo-4-thia-1-azabicycloheptane-2-carboxylateSmiles : .CC1ON=C(C=1C(=O)N12SC(C)(C)(C()=O)N2C1=O)C1=C(F)C=CC=C1ClInChiKey: OTEANHMVDHZOPB-SLINCCQESA-MInChi : InChI=1S/C19H17ClFN3O5S.Na/c1-7-10(12(23-29-7)11-8(20)5-4-6-9(11)21)15(25)22-13-16(26)24-14(18(27)28)19(2,3)30-17(13)24;/h4-6,13-14,17H,1-3H3,(H,22,25)(H,27,28);/q;+1/p-1/t13-,14+,17-;/m1./s1Purity: ≥98% (or refer…
Stylophorin
Product Name : StylophorinSynonym : (+)-ChelidonineChemical Name : CAS NO.: 476-32-4Molecular formula : C20H19NO5Molecular Weight: 353.37 g/molClassification : MedChemExpress Products > Natural Products > StylophorinDescription: Stylophorin is a natural product…
Z-L-aspartic acid-beta-benzyl ester
Product Name : Z-L-aspartic acid-beta-benzyl esterSynonym : Z-L-Asp(OBzl)-OHChemical Name : CAS NO.: 3479-47-8Molecular formula : C19H19NO6Molecular Weight: 357.36 g/molClassification : MedChemExpress Products > Research Chemicals >Fine Chemicals > Z-L-aspartic acid-beta-benzyl…
Deramciclane
Product Name : DeramciclaneSynonym : Chemical Name : CAS NO.: 120444-71-5Molecular formula : C20H31NOMolecular Weight: 301.5 g/molClassification : MedChemExpress Products > Life Sciences > Ligands > DeramciclaneDescription: Deramciclane is a…
Salvianolic acid A
Product Name : Salvianolic acid ADescription:Salvianolic acid A could protect the blood brain barrier through matrix metallopeptidase 9 (MMP-9) inhibition and anti-inflammation.CAS: 96574-01-5Molecular Weight:494.45Formula: C26H22O10Chemical Name: 3-(3,4-dihydroxyphenyl)-2--3,4-dihydroxyphenyl}prop-2-enoyl)oxy]propanoic acidSmiles : OC(=O)C(CC1=CC(O)=C(O)C=C1)OC(=O)C=CC1C=CC(O)=C(O)C=1C=CC1=CC(O)=C(O)C=C1InChiKey:…
3-Isobutyl-1-methylxanthine
Product Name : 3-Isobutyl-1-methylxanthineSynonym : 3,9-Dihydro-1-methyl-3-(2-methylpropyl)-1H-purine-2,6-dioneIBMX1-Methyl-3-isobutylxanthineChemical Name : CAS NO.: 28822-58-4Molecular formula : C10H14N4O2Molecular Weight: 222.24 g/molClassification : MedChemExpress Products > Research Chemicals > 3-Isobutyl-1-methylxanthineDescription: A non-specific inhibitor of cAMP…
Benzo[b]furan-2-boronic acid
Product Name : Benzofuran-2-boronic acidSynonym : Chemical Name : CAS NO.: 98437-24-2Molecular formula : C8H7BO3Molecular Weight: 161.95 g/molClassification : MedChemExpress Products > Research Chemicals > Building Blocks > Oxygen and…
1-(Methyl-d3)-N-[(3-endo)-9-methyl-9-azabicyclo[3.3.1]non-3-yl]-1H-indazole-3-carboxamide
Product Name : 1-(Methyl-d3)-N-non-3-yl]-1H-indazole-3-carboxamideSynonym : Chemical Name : CAS NO.: 1224925-76-1Molecular formula : C18H24N4OMolecular Weight: 315.4 g/molClassification : MedChemExpress Products > Controlled Products > 1-(Methyl-d3)-N-non-3-yl]-1H-indazole-3-carboxamideDescription: 1-(Methyl-d3)-N-non-3-yl]-1H-indazole-3-carboxamide is a potent protein…
BAY-85-8501
Product Name : BAY-85-8501Description:BAY-85-8501 is a selective, reversible and potent inhibitor of Human Neutrophil Elastase (HNE), with an IC50 of 65 pM.CAS: 1161921-82-9Molecular Weight:474.46Formula: C22H17F3N4O3SChemical Name: (4S)-4-(4-cyano-2-methanesulfonylphenyl)-3,6-dimethyl-2-oxo-1--1,2,3,4-tetrahydropyrimidine-5-carbonitrileSmiles : CN1(C(C#N)=C(C)N(C1=O)C1C=C(C=CC=1)C(F)(F)F)C1=CC=C(C=C1S(C)(=O)=O)C#NInChiKey: YAJWYFPMASPAMM-HXUWFJFHSA-NInChi…
Amoxicillin sodium
Product Name : Amoxicillin sodiumSynonym : Chemical Name : CAS NO.: 34642-77-8Molecular formula : C16H18N3NaO5SMolecular Weight: 387.39 g/molClassification : MedChemExpress Products > Research Chemicals >Fine Chemicals > Amoxicillin sodiumDescription: Amoxicillin…
Roseoflavin
Product Name : RoseoflavinSynonym : 8-Demethyl-8-(dimethylamino)riboflavinChemical Name : CAS NO.: 51093-55-1Molecular formula : C18H23N5O6Molecular Weight: 405.41 g/molClassification : MedChemExpress Products > Natural Products > RoseoflavinDescription: Roseoflavin is a redox cofactor…
Vortioxetine
Product Name : VortioxetineSynonym : 1-phenyl]-piperazine Vortioxetine 1-(2-((2,4-Dimethylphenyl)thio)phenyl)piperazineChemical Name : CAS NO.: 508233-74-7Molecular formula : C18H22N2SMolecular Weight: 298.45 g/molClassification : MedChemExpress Products > Controlled Products > VortioxetineDescription: Vortioxetine is a…
CHK1 inhibitor
Product Name : CHK1 inhibitorDescription:CHK1 inhibitor (GDC-0575 analog) is an inhibitor of CHK1.CAS: 2097938-64-0Molecular Weight:377.28Formula: C17H21BrN4OChemical Name: N-{4--5-bromo-1H-indol-3-yl}cyclopropanecarboxamideSmiles : N1CN(CCC1)C1C2=C(C=CC=1Br)NC=C2NC(=O)C1CC1InChiKey: HZEPWUQMONRPSF-LLVKDONJSA-NInChi : InChI=1S/C17H21BrN4O/c18-12-5-6-13-15(16(12)22-7-1-2-11(19)9-22)14(8-20-13)21-17(23)10-3-4-10/h5-6,8,10-11,20H,1-4,7,9,19H2,(H,21,23)/t11-/m1/s1Purity: ≥98% (or refer to the Certificate of…
Erucic acid methyl ester
Product Name : Erucic acid methyl esterSynonym : Chemical Name : CAS NO.: 1120-34-9Molecular formula : C23H44O2Molecular Weight: 352.59 g/molClassification : MedChemExpress Products > Research Chemicals > Erucic acid methyl…
Spironolactone
Product Name : SpironolactoneSynonym : 17-Hydroxy-7-alpha-mercapto-3-oxo-17-alpha-pregn-4-ene-21-carboxylic acid-gamma-lactone-7-acetateChemical Name : CAS NO.: 52-01-7Molecular formula : C24H32O4SMolecular Weight: 416.57 g/molClassification : MedChemExpress Products > Research Chemicals > SpironolactoneDescription: Mineralocorticoid (aldosterone) receptor antagonist;…
YF-2 hydrochloride
Product Name : YF-2 hydrochlorideSynonym : Chemical Name : CAS NO.: 1312005-62-1Molecular formula : C20H23Cl2F3N2O3Molecular Weight: 467.3 g/molClassification : MedChemExpress Products > Life Sciences > YF-2 hydrochlorideDescription: YF-2 is a…
Urocanic acid
Product Name : Urocanic acidDescription:Urocanic acid, produced in the upper layers of mammalian skin, is a major absorber of ultraviolet radiation (UVR).CAS: 104-98-3Molecular Weight:138.12Formula: C6H6N2O2Chemical Name: (2E)-3-(1H-imidazol-5-yl)prop-2-enoic acidSmiles : OC(=O)/C=C/C1=CN=CN1InChiKey:…
Oroxylin A
Product Name : Oroxylin ASynonym : 5,7-Dihydroxy-6-methoxyflavoneChemical Name : CAS NO.: 480-11-5Molecular formula : C16H12O5Molecular Weight: 284.26 g/molClassification : MedChemExpress Products > Natural Products > Flavonoids > Flavones and Isoflavones…
mPEG9-CH2COOH
Product Name : mPEG9-CH2COOHSynonym : Chemical Name : CAS NO.: 405518-55-0Molecular formula : C21H42O12Molecular Weight: 486.55 g/molClassification : MedChemExpress Products > PEG Polymers > mPEG9-CH2COOHDescription: mPEG9-CH2COOH is a heterobifunctional PEG…
N-PEG3-N’-(propargyl-PEG4)-Cy5
Product Name : N-PEG3-N'-(propargyl-PEG4)-Cy5Synonym : Chemical Name : CAS NO.: 2107273-06-1Molecular formula : C42H57ClN2O7Molecular Weight: 737.4 g/molClassification : MedChemExpress Products > Research Chemicals > N-PEG3-N'-(propargyl-PEG4)-Cy5Description: N-PEG3-N'-(propargyl-PEG4)-Cy5 is a ligand that…
Hecogenin acetate
Product Name : Hecogenin acetateDescription:Hecogenin acetate is a steroidal sapogenin-acetylated with anti-inflammatory and antinociceptive. Hecogenin acetate shows potential antihyperalgesic activity, inhibiting descending pain and acting in opioid receptors.CAS: 915-35-5Molecular Weight:472.66Formula:…
Decanoyl-L-carnitine
Product Name : Decanoyl-L-carnitineSynonym : Chemical Name : CAS NO.: 3992-45-8Molecular formula : C17H33NO4Molecular Weight: 315.45 g/molClassification : MedChemExpress Products > Research Chemicals > Decanoyl-L-carnitineDescription: Decanoyl-L-carnitine is a fatty acid…
2,6-Dimethyl-4H-pyran-4-one
Product Name : 2,6-Dimethyl-4H-pyran-4-oneSynonym : Chemical Name : CAS NO.: 1004-36-0Molecular formula : C7H8O2Molecular Weight: 124.14 g/molClassification : MedChemExpress Products > Research Chemicals > 2,6-Dimethyl-4H-pyran-4-oneDescription: 2,6-Dimethyl-4H-pyran-4-one is a monosubstituted carbonyl…
(Rac)-PF-06256142
Product Name : (Rac)-PF-06256142Synonym : Chemical Name : CAS NO.: 1609580-97-3Molecular formula : C21H16N4O2Molecular Weight: 356.4 g/molClassification : MedChemExpress Products > Life Sciences > (Rac)-PF-06256142Description: (Rac)-PF-06256142 is a peptide that…
BIBS 39
Product Name : BIBS 39Description:BIBS 39 is a new nonpeptide angiotensin II (AII) receptor antagonist.Target: Angiotensin Receptorin vitro: BIBS 39 displaces AII from its specific binding sites with a Ki…
L-Asparagine monohydrate
Product Name : L-Asparagine monohydrateSynonym : Chemical Name : CAS NO.: 5794-13-8Molecular formula : C4H10N2O4Molecular Weight: 150.13 g/molClassification : MedChemExpress Products > Research Chemicals >Fine Chemicals > L-Asparagine monohydrateDescription: L-Asparagine…
Prostaglandin f3α
Product Name : Prostaglandin f3αSynonym : Chemical Name : CAS NO.: 745-64-2Molecular formula : C20H32O5Molecular Weight: 352.5 g/molClassification : MedChemExpress Products > Research Chemicals > Prostaglandin f3αDescription: Prostaglandin F3α is…
Lodelcizumab
Product Name : LodelcizumabSynonym : Chemical Name : CAS NO.: 1355338-54-3Molecular formula : Molecular Weight: Classification : MedChemExpress Products > Life Sciences > Antibodies > Monoclonal Antibodies > LodelcizumabDescription: Recombinant…
BVT948
Product Name : BVT948Description:BVT948 is a protein tyrosine phosphatase (PTP) inhibitor which can also inhibit several cytochrome P450 (P450) isoforms and lysine methyltransferase SETD8 (KMT5A).CAS: 39674-97-0Molecular Weight:241.24Formula: C14H11NO3Chemical Name: 3,3-dimethyl-1H,2H,3H,4H,5H-benzoindole-2,4,5-trioneSmiles…
Recilisib sodium
Product Name : Recilisib sodiumSynonym : Chemical Name : CAS NO.: 922139-31-9Molecular formula : C16H12ClNaO4SMolecular Weight: 358.8 g/molClassification : MedChemExpress Products > Life Sciences > Ligands > Recilisib sodiumDescription: Recilisib…
Eosin Y disodium salt – 5wt % in H2O
Product Name : Eosin Y disodium salt - 5wt % in H2OSynonym : Acid red 87 C.I. 45380 Eosyn Y 4′,5′-DibromofluoresceinChemical Name : CAS NO.: 17372-87-1Molecular formula : C20H6Br4Na2O5Molecular Weight:…
β-Amyron
Product Name : β-AmyronSynonym : Chemical Name : CAS NO.: 638-97-1Molecular formula : C30H48OMolecular Weight: 424.7 g/molClassification : MedChemExpress Products > Controlled Products > β-AmyronDescription: β-Amyron is a natural product…
ML240
Product Name : ML240Description:ML240 is a potent p97 inhibitor, inhibiting p97 ATPase with IC50 value of 100 nM.CAS: 1346527-98-7Molecular Weight:396.44Formula: C23H20N6OChemical Name: 2-(2-amino-1H-1,3-benzodiazol-1-yl)-N-benzyl-8-methoxyquinazolin-4-amineSmiles : COC1C=CC=C2C(NCC3C=CC=CC=3)=NC(=NC=12)N1C(N)=NC2C=CC=CC1=2InChiKey: NHAMBLRUUJAFOY-UHFFFAOYSA-NInChi : InChI=1S/C23H20N6O/c1-30-19-13-7-10-16-20(19)27-23(28-21(16)25-14-15-8-3-2-4-9-15)29-18-12-6-5-11-17(18)26-22(29)24/h2-13H,14H2,1H3,(H2,24,26)(H,25,27,28)Purity: ≥98% (or…
Rocuronium
Product Name : RocuroniumSynonym : Chemical Name : CAS NO.: 143558-00-3Molecular formula : C32H53N2O4+Molecular Weight: 529.8 g/molClassification : MedChemExpress Products > Impurities > RocuroniumDescription: Rocuronium is a potent muscle relaxant…
2,4,6-Trihydroxybenzaldehyde
Product Name : 2,4,6-TrihydroxybenzaldehydeSynonym : Chemical Name : CAS NO.: 487-70-7Molecular formula : C7H6O4Molecular Weight: 154.12 g/molClassification : MedChemExpress Products > Research Chemicals > Building Blocks > Benzaldehydes > 2,4,6-TrihydroxybenzaldehydeDescription:…
Thiol-PEG3-acid
Product Name : Thiol-PEG3-acidSynonym : Chemical Name : CAS NO.: 1347750-82-6Molecular formula : C9H18O5SMolecular Weight: 238.3 g/molClassification : MedChemExpress Products > PEG Polymers > Thiol-PEG3-acidDescription: Thiol-PEG3-acid is a heterobifunctional PEG…
cis-Vitamin K1
Product Name : cis-Vitamin K1Synonym : 2-Methyl-3--1,4-naphthalenedione]-2-Methyl-3-(3,7,11,15-tetrameth yl-2-hexadecenyl)-1,4-naphthalenedioneChemical Name : CAS NO.: 16033-41-3Molecular formula : C31H46O2Molecular Weight: 450.7 g/molClassification : MedChemExpress Products > Research Chemicals > cis-Vitamin K1Description: Vitamin K…
Pritumumab
Product Name : PritumumabSynonym : Chemical Name : CAS NO.: 499212-74-7Molecular formula : Molecular Weight: Classification : MedChemExpress Products > Life Sciences > Antibodies > Monoclonal Antibodies > PritumumabDescription: Anti-vimentin…
Agrostophyllidin
Product Name : AgrostophyllidinSynonym : Chemical Name : CAS NO.: 178439-50-4Molecular formula : C17H16O4Molecular Weight: 284.31 g/molClassification : MedChemExpress Products > Natural Products > AgrostophyllidinDescription: Agrostophyllidin is a natural product…
2-Hydroxyhexanoic acid
Product Name : 2-Hydroxyhexanoic acidSynonym : Chemical Name : CAS NO.: 6064-63-7Molecular formula : C6H12O3Molecular Weight: 132.16 g/molClassification : MedChemExpress Products > Research Chemicals > 2-Hydroxyhexanoic acidDescription: 2-Hydroxyhexanoic acid is…
BP897
Product Name : BP897Synonym : Chemical Name : CAS NO.: 314776-92-6Molecular formula : C26H31N3O2Molecular Weight: 417.54 g/molClassification : MedChemExpress Products > Life Sciences > BP897Description: BP897 is a dopamine receptor…
N-Phenylacrylamide
Product Name : N-PhenylacrylamideSynonym : Chemical Name : CAS NO.: 2210-24-4Molecular formula : C9H9NOMolecular Weight: 147.17 g/molClassification : MedChemExpress Products > Research Chemicals > N-PhenylacrylamideDescription: N-Phenylacrylamide is an organic compound…
DNP-dPEG®12-NHS Ester
Product Name : DNP-dPEG®12-NHS EsterSynonym : Chemical Name : CAS NO.: 1333154-70-3Molecular formula : C60H110N6O28Molecular Weight: 1,363.54 g/molClassification : MedChemExpress Products > Life Sciences > DNP-dPEG®12-NHS EsterDescription: DNP-dPEG®12-NHS Ester is…
Fluorescent red 610
Product Name : Fluorescent red 610Synonym : Chemical Name : CAS NO.: 482379-37-3Molecular formula : C32H42N3NaO9SMolecular Weight: 667.7 g/molClassification : MedChemExpress Products > Research Chemicals > Fluorescent red 610Description: Fluorescent…
Perospirone HCl hydrate – Bio-X ™
Product Name : Perospirone HCl hydrate - Bio-X ™Synonym : Chemical Name : CAS NO.: 129273-38-7Molecular formula : C23H30N4O2S·HCl·2H2OMolecular Weight: 499.10 g/molClassification : MedChemExpress Products > Life Sciences > Ligands…
β-Amino acid imagabalin hydrochloride
Product Name : β-Amino acid imagabalin hydrochlorideSynonym : Chemical Name : CAS NO.: 610300-00-0Molecular formula : C9H20ClNO2Molecular Weight: 209.71 g/molClassification : MedChemExpress Products > Life Sciences > β-Amino acid imagabalin…
Malvidin-3-galactoside chloride
Product Name : Malvidin-3-galactoside chlorideSynonym : PrimulinChemical Name : CAS NO.: 30113-37-2Molecular formula : C23H25ClO12Molecular Weight: 528.89 g/molClassification : MedChemExpress Products > Natural Products > Anthocyanidins > Malvidin-3-galactoside chlorideDescription: Malvidin-3-galactoside…
Indole-2-carboxylic acid
Product Name : Indole-2-carboxylic acidSynonym : Chemical Name : CAS NO.: 1477-50-5Molecular formula : C9H7NO2Molecular Weight: 161.16 g/molClassification : MedChemExpress Products > Research Chemicals > Indole-2-carboxylic acidDescription: Indole-2-carboxylic acid is…
M-PEG11-acid
Product Name : M-PEG11-acidSynonym : Chemical Name : CAS NO.: 2280998-74-3Molecular formula : C24H48O13Molecular Weight: 544.6 g/molClassification : MedChemExpress Products > Research Chemicals > M-PEG11-acidDescription: M-PEG11-acid is a pegylation reagent…
Prostaglandin F2a
Product Name : Prostaglandin F2aSynonym : (5Z,9a,11a,13E,15S)-9,11,15-Trihydroxyprosta-5,13-dien-1-oic acid7--5-heptenoic a cid(+)-Prostaglandin F2aDinoprostChemical Name : CAS NO.: 551-11-1Molecular formula : C20H34O5Molecular Weight: 354.48 g/molClassification : MedChemExpress Products > Life Sciences > Prostaglandin…
Morroniside – Bio-X ™
Product Name : Morroniside - Bio-X ™Synonym : Methyl (1S,3R,4aS,8S,8aS)-8-(b-D-glucopyranosyloxy)-3-hydroxy-1-methyl-4,4a,8,8a-tetrahydro-1H,3H-pyranopyran-5-carboxylaChemical Name : CAS NO.: 25406-64-8Molecular formula : C17H26O11Molecular Weight: 406.38 g/molClassification : MedChemExpress Products > Natural Products > Morroniside -…
SNDX-5613
Product Name : SNDX-5613Synonym : Chemical Name : CAS NO.: 2169919-21-3Molecular formula : C32H47FN6O4SMolecular Weight: 630.8 g/molClassification : MedChemExpress Products > Life Sciences > SNDX-5613Description: Revumenib, also known as SNDX-5613, is…
Potassium clavulanate – 1:1 mixture with silicon dioxide
Product Name : Potassium clavulanate - 1:1 mixture with silicon dioxideSynonym : Chemical Name : CAS NO.: 61177-45-5Molecular formula : C8H8NO5·KMolecular Weight: 237.25 g/molClassification : MedChemExpress Products > Research Chemicals…
4-Nitrophenyl a-L-arabinopyranoside
Product Name : 4-Nitrophenyl a-L-arabinopyranosideSynonym : PNP-a-arabinosideChemical Name : CAS NO.: 1223-07-0Molecular formula : C11H13NO7Molecular Weight: 271.22 g/molClassification : MedChemExpress Products > Enzyme Substrates > Chromogenic Substrates > pNP Substrates…
Karenitecin
Product Name : KarenitecinSynonym : Chemical Name : CAS NO.: 203923-89-1Molecular formula : C25H28N2O4SiMolecular Weight: 448.6 g/molClassification : MedChemExpress Products > Life Sciences > KarenitecinDescription: Karenitecin is a diagnostic agent…
Bepotastine besilate
Product Name : Bepotastine besilateSynonym : (+)-(S)-4-piperidin-1-yl]butyric acid benzenesulfonateChemical Name : CAS NO.: 125602-71-3Molecular formula : C21H25ClN2O3•C6H6O3SMolecular Weight: 547.06 g/molClassification : MedChemExpress Products > Life Sciences > Ligands > Histamine…
5-Methoxy-2-[[(4-methoxy-3,5-dimethyl-2-pyridinyl)methyl]thio]-1H-benzimidazole
Product Name : 5-Methoxy-2-thio]-1H-benzimidazoleSynonym : Omeprazole sulfide6-Methoxy-2-thio]-1H-benzimidazole2-thio]-5-methoxybenzimidazolePyrmetazoleChemical Name : CAS NO.: 73590-85-9Molecular formula : C17H19N3O2SMolecular Weight: 329.42 g/molClassification : MedChemExpress Products > Impurities > iOmeprazole > 5-Methoxy-2-thio]-1H-benzimidazoleDescription: Omeprazole is a…
M2I-1
Product Name : M2I-1Synonym : Chemical Name : CAS NO.: 312271-03-7Molecular formula : C19H24N4O4SMolecular Weight: 404.48 g/molClassification : MedChemExpress Products > Life Sciences > M2I-1Description: M2I-1 is a molecule that…
Uridine 5′-diphosphate disodium salt
Product Name : Uridine 5'-diphosphate disodium saltSynonym : UDP.2NaChemical Name : CAS NO.: 27821-45-0Molecular formula : C9H12N2O12P2Na2Molecular Weight: 448.12 g/molClassification : MedChemExpress Products > Nucleosides > Nucleosides, Nucleotides and Nucleic…
rac-Propranolol hydrochloride
Product Name : rac-Propranolol hydrochlorideSynonym : 1-3-(1-naphthalenyloxy)-2-propanol hydrochlorideAngilolApsolol(±)-Propranolol hydrochlorideChemical Name : CAS NO.: 318-98-9Molecular formula : C16H22ClNO2Molecular Weight: 295.8 g/molClassification : MedChemExpress Products > Research Chemicals > rac-Propranolol hydrochlorideDescription: Propranolol…
2-Amino-4-bromopyridine
Product Name : 2-Amino-4-bromopyridineSynonym : Chemical Name : CAS NO.: 84249-14-9Molecular formula : C5H5BrN2Molecular Weight: 173.01 g/molClassification : MedChemExpress Products > Research Chemicals > Building Blocks > Nitrogen Heterocycles >…
8Beta,9Alpha-Dihydroxylindan-4(5),7(11)-dien-8alpha,12-olide
Product Name : 8Beta,9Alpha-Dihydroxylindan-4(5),7(11)-dien-8alpha,12-olideSynonym : Chemical Name : CAS NO.: 956707-04-3Molecular formula : C15H18O4Molecular Weight: 262.30 g/molClassification : MedChemExpress Products > Natural Products > 8Beta,9Alpha-Dihydroxylindan-4(5),7(11)-dien-8alpha,12-olideDescription: 8,9-Dihydroxylindan-4(5),7(11)-dien-8alpha,12-olide is a natural product…
4-[Bis(2-chloroethyl)aminophenyl]butyric acid
Product Name : 4-butyric acidSynonym : ChlorambucilChemical Name : CAS NO.: 305-03-3Molecular formula : C14H19Cl2NO2Molecular Weight: 304.21 g/molClassification : MedChemExpress Products > Research Chemicals > 4-butyric acidDescription: 4-butyric acid is…
st-Ht31
Product Name : st-Ht31Synonym : Chemical Name : CAS NO.: 188425-80-1Molecular formula : C129H217N29O39Molecular Weight: 2,798.3 g/molClassification : MedChemExpress Products > Life Sciences > st-Ht31Description: ST-Ht31 is a cyclic nucleotide…
Tilapertin
Product Name : TilapertinSynonym : Chemical Name : CAS NO.: 1000690-85-6Molecular formula : C20H21F3N2O2Molecular Weight: 378.4 g/molClassification : MedChemExpress Products > Life Sciences > TilapertinDescription: Tilapertin is a drug that…
5-(4-(2-(5-Ethylpyridin-2-yl)-2-oxoethoxy)benzyl)thiazolidine-2,4-dione
Product Name : 5-(4-(2-(5-Ethylpyridin-2-yl)-2-oxoethoxy)benzyl)thiazolidine-2,4-dioneSynonym : Chemical Name : CAS NO.: 146062-49-9Molecular formula : C19H18N2O4SMolecular Weight: 370.43 g/molClassification : MedChemExpress Products > Research Chemicals > 5-(4-(2-(5-Ethylpyridin-2-yl)-2-oxoethoxy)benzyl)thiazolidine-2,4-dioneDescription: 5-(4-(2-(5-Ethylpyridin-2-yl)-2-oxoethoxy)benzyl)thiazolidine-2,4-dione (5EPC) is a drug…
GW 441756
Product Name : GW 441756Description:GW-441756 is a potent inhibitor of TrkA (IC50 = 2 nM). Trk inhibition reduces cell proliferation and potentiates the effects of chemotherapeutic agents in Ewing sarcoma.CAS:…
1-(1-(2-(Hexahydrocyclopenta[C]pyrrol-2(1H)-yl)-2-oxoethyl)piperidin-4-yl)-N-methyl-2-oxoindoline-5-carboxamide
Product Name : 1-(1-(2-(Hexahydrocyclopentapyrrol-2(1H)-yl)-2-oxoethyl)piperidin-4-yl)-N-methyl-2-oxoindoline-5-carboxamideSynonym : Chemical Name : CAS NO.: 1037837-27-6Molecular formula : C24H32N4O3Molecular Weight: 424.5 g/molClassification : MedChemExpress Products > Life Sciences > 1-(1-(2-(Hexahydrocyclopentapyrrol-2(1H)-yl)-2-oxoethyl)piperidin-4-yl)-N-methyl-2-oxoindoline-5-carboxamideDescription: 1-(1-(2-(Hexahydrocyclopentapyrrol-2(1H)-yl)-2-oxoethyl)piperidin-4-yl)-N-methyl-2-oxoindoline-5-carboxamide is a peptide that…
(4-Carbamoylphenyl)boronic acid
Product Name : (4-Carbamoylphenyl)boronic acidSynonym : Chemical Name : CAS NO.: 123088-59-5Molecular formula : C7H8BNO3Molecular Weight: 164.95 g/molClassification : MedChemExpress Products > Research Chemicals > (4-Carbamoylphenyl)boronic acidDescription: 4-Carbamoylphenyl)boronic acid is…
L-Alanyl-L-glutamine
Product Name : L-Alanyl-L-glutamineSynonym : H-Ala-Gln-OHChemical Name : CAS NO.: 39537-23-0Molecular formula : C8H15N3O4Molecular Weight: 217.22 g/molClassification : MedChemExpress Products > Research Chemicals >Fine Chemicals > L-Alanyl-L-glutamineDescription: Stable substitute for…
Leuprolide acetate
Product Name : Leuprolide acetateDescription:Leuprolide acetate is the acetate salt of a synthetic nonapeptide analogue of gonadotropin-releasing hormone. Leuprolide binds to and activates gonadotropin-releasing hormone (GnRH) receptors. Continuous, prolonged administration…
Albutoin
Product Name : AlbutoinSynonym : 5-(2-Methylpropyl)-3-(prop-2-en-1-yl)-2-sulfanylideneimidazolidin-4-oneChemical Name : CAS NO.: 830-89-7Molecular formula : C10H16N2OSMolecular Weight: 212.31 g/molClassification : MedChemExpress Products > Research Chemicals >Fine Chemicals > AlbutoinDescription: Albutoin is a…
7-[(3S)-3-Amino-1-oxo-4-(2,4,5-trifluorophenyl)butyl]-5,6,7,8-tetrahydro-3-(trifluoromethyl)-1,2,4-triazolo[4,3-a]pyrazine phosphate (1:1)
Product Name : 7--5,6,7,8-tetrahydro-3-(trifluoromethyl)-1,2,4-triazolopyrazine phosphate (1:1)Synonym : Chemical Name : CAS NO.: 823817-58-9Molecular formula : C16H15F6N5O•H3PO4Molecular Weight: 505.31 g/molClassification : MedChemExpress Products > Research Chemicals >Fine Chemicals > 7--5,6,7,8-tetrahydro-3-(trifluoromethyl)-1,2,4-triazolopyrazine phosphate…
Abacavir sulfate – Bio-X ™
Product Name : Abacavir sulfate - Bio-X ™Synonym : Chemical Name : CAS NO.: 188062-50-2Molecular formula : C14H18N6O·½H2SO4Molecular Weight: 670.75 g/molClassification : MedChemExpress Products > Antimicrobials > Antivirals > Abacavir…
PND-1186
Product Name : PND-1186Description:PND-1186, also known as SR-2156 and VS-4718, is a potent FAK inhibitor with a 50% inhibitory concentration (IC50) of 1.5 nM in vitro. PND-1186 has an IC50…
N-methyl-4-(phenylmethoxy)-1-piperidineethanamine dihydrochloride
Product Name : N-methyl-4-(phenylmethoxy)-1-piperidineethanamine dihydrochlorideSynonym : Chemical Name : CAS NO.: 2095432-59-8Molecular formula : C15H26Cl2N2OMolecular Weight: 321.3 g/molClassification : MedChemExpress Products > Research Chemicals > N-methyl-4-(phenylmethoxy)-1-piperidineethanamine dihydrochlorideDescription: N-methyl-4-(phenylmethoxy)-1-piperidineethanamine dihydrochloride is…
N-Formyl-Met-Leu-Phe-Lys
Product Name : N-Formyl-Met-Leu-Phe-LysSynonym : Chemical Name : CAS NO.: 67247-11-4Molecular formula : C27H43N3O6SMolecular Weight: 537.71 g/molClassification : MedChemExpress Products > Research Chemicals > N-Formyl-Met-Leu-Phe-LysDescription: N-Formyl-Met-Leu-Phe-Lys is a reactive lysine…
Tc-I 15
Product Name : Tc-I 15Synonym : Chemical Name : CAS NO.: 916734-43-5Molecular formula : C23H28N4O6S2Molecular Weight: 520.6 g/molClassification : MedChemExpress Products > Life Sciences > Tc-I 15Description: Tc-I 15 is…
Escitalopram (oxalate)
Product Name : Escitalopram (oxalate)Description:Escitalopram Oxalate is a furancarbonitrile that is one of the selective serotonin uptake inhibitors used as an antidepressant. As a selective serotonin reuptake inhibitor (SSRI), escitalopram…
Redaporfin
Product Name : RedaporfinSynonym : Chemical Name : CAS NO.: 1224104-08-8Molecular formula : C48H38F8N8O8S4Molecular Weight: 1,135.1 g/molClassification : MedChemExpress Products > Impurities > RedaporfinDescription: Redaporfin is an analog of the…
UNC 0638
Product Name : UNC 0638Synonym : Chemical Name : CAS NO.: 1255580-76-7Molecular formula : C30H47N5O2Molecular Weight: 509.73 g/molClassification : MedChemExpress Products > Research Chemicals > UNC 0638Description: UNC 0638 is…
Bac2A trifluoroacetate
Product Name : Bac2A trifluoroacetateSynonym : Chemical Name : CAS NO.: 231306-42-6Molecular formula : C63H121N25O12•(C2HF3O2)xMolecular Weight: 1,420.8 g/molClassification : MedChemExpress Products > Life Sciences > Bac2A trifluoroacetateDescription: The Bac2A trifluoroacetate…
AZD1283
Product Name : AZD1283Description:AZD1283 is a potent antagonist of the P2Y12 receptor. In a modified Folts model in dog, both AZD1283 dose-dependently induced increases in blood flow and inhibition of…
3-Methyl-2-buten-1-ol
Product Name : 3-Methyl-2-buten-1-olSynonym : Chemical Name : CAS NO.: 556-82-1Molecular formula : C5H10OMolecular Weight: 86.13 g/molClassification : MedChemExpress Products > Research Chemicals > 3-Methyl-2-buten-1-olDescription: 3-Methyl-2-buten-1-ol is an organic compound…
GK921
Product Name : GK921Synonym : Chemical Name : CAS NO.: 1025015-40-0Molecular formula : C21H20N4OMolecular Weight: 344.41 g/molClassification : MedChemExpress Products > Life Sciences > GK921Description: GK921 is a drug candidate…
Sulfaquinoxaline-d4
Product Name : Sulfaquinoxaline-d4Synonym : Chemical Name : CAS NO.: 1329652-02-9Molecular formula : C14H8D4N4O2SMolecular Weight: 304.36 g/molClassification : MedChemExpress Products > Impurities > Sulfaquinoxaline-d4Description: Sulfaquinoxaline-d4 is a synthetic compound that…
Camobucol
Product Name : CamobucolDescription:Camobucol (AGIX 4207) is an orally active, phenolic antioxidant and anti-inflammatory compound with antirheumatic properties.CAS: 216167-92-9Molecular Weight:574.88Formula: C33H50O4S2Chemical Name: 2-propan-2-yl}sulfanyl)phenoxy]acetic acidSmiles : CC(C)(C)C1C=C(C=C(C=1OCC(O)=O)C(C)(C)C)SC(C)(C)SC1=CC(=C(O)C(=C1)C(C)(C)C)C(C)(C)CInChiKey: FGBGXESDYFKUFX-UHFFFAOYSA-NInChi : InChI=1S/C33H50O4S2/c1-29(2,3)22-15-20(16-23(27(22)36)30(4,5)6)38-33(13,14)39-21-17-24(31(7,8)9)28(37-19-26(34)35)25(18-21)32(10,11)12/h15-18,36H,19H2,1-14H3,(H,34,35)Purity: ≥98%…
N4-Benzoyl-2′-O-tert-butyldimethylsilyl-5′-O-DMT-cytidine 3′-CE phosphoramidite
Product Name : N4-Benzoyl-2'-O-tert-butyldimethylsilyl-5'-O-DMT-cytidine 3'-CE phosphoramiditeSynonym : N-Bz-2'-O-TBDMS-5'-DMT-cytidine 3'-CE phosphoramiditeChemical Name : CAS NO.: 118380-84-0Molecular formula : C52H66N5O9PSiMolecular Weight: 964.19 g/molClassification : MedChemExpress Products > Nucleosides > N4-Benzoyl-2'-O-tert-butyldimethylsilyl-5'-O-DMT-cytidine 3'-CE phosphoramiditeDescription:…
(-)-Nortrachelogenin
Product Name : (-)-NortrachelogeninSynonym : Chemical Name : CAS NO.: 34444-37-6Molecular formula : C20H22O7Molecular Weight: 374.38 g/molClassification : MedChemExpress Products > Natural Products > (-)-NortrachelogeninDescription: (-)-Nortrachelogenin is an enzyme inhibitor…
Lamotrigine
Product Name : LamotrigineSynonym : 6-(2,3-Dichlorophenyl)-1,2,4-triazine-3,5-diamine3,5-Diamino-6-(2,3-dichlorophenyl)-1,2,4-triazineChemical Name : CAS NO.: 84057-84-1Molecular formula : C9H7Cl2N5Molecular Weight: 256.09 g/molClassification : MedChemExpress Products > Research Chemicals > LamotrigineDescription: Sodium channel blocker; antilepticPurity :…
UMB298
Product Name : UMB298Description:UMB298 is a potent and selective CBP/P300 bromodomain inhibitor.CAS: 2266569-73-5Molecular Weight:479.01Formula: C27H31ClN4O2Chemical Name: 2--N-cyclohexyl-7-(3,5-dimethyl-1,2-oxazol-4-yl)imidazopyridin-3-amineSmiles : COC1=CC=C(CCC2N=C3C=C(C=CN3C=2NC2CCCCC2)C2C(C)=NOC=2C)C=C1ClInChiKey: NZXSWCLCRDCHGN-UHFFFAOYSA-NInChi : InChI=1S/C27H31ClN4O2/c1-17-26(18(2)34-31-17)20-13-14-32-25(16-20)30-23(27(32)29-21-7-5-4-6-8-21)11-9-19-10-12-24(33-3)22(28)15-19/h10,12-16,21,29H,4-9,11H2,1-3H3Purity: ≥98% (or refer to the Certificate of Analysis)Shipping…
ONO 5334
Product Name : ONO 5334Synonym : Chemical Name : CAS NO.: 868273-90-9Molecular formula : Molecular Weight: Classification : MedChemExpress Products > Life Sciences > ONO 5334Description: Cathepsin K inhibitorPurity :…
1-(2-Thiazolylazo)-2-naphthol – Bio-X ™
Product Name : 1-(2-Thiazolylazo)-2-naphthol - Bio-X ™Synonym : Chemical Name : CAS NO.: 1147-56-4Molecular formula : C13H9N3OSMolecular Weight: 255.3 g/molClassification : MedChemExpress Products > Research Chemicals > 1-(2-Thiazolylazo)-2-naphthol - Bio-X…
Methacrylamide
Product Name : MethacrylamideSynonym : Chemical Name : CAS NO.: 79-39-0Molecular formula : C4H7NOMolecular Weight: 85.1 g/molClassification : MedChemExpress Products > Research Chemicals > MethacrylamideDescription: Methacrylamide is a monomer that…
ALK4290
Product Name : ALK4290Description:ALK4290 (AKST4290) is a potent and orally actively CCR3 inhibitor extracted from patent US20130261153A1, compound Example 2, with a Ki of 3.2 nM for hCCR3. ALK4290 can…
Piperonyl acetone
Product Name : Piperonyl acetoneSynonym : Chemical Name : CAS NO.: 55418-52-5Molecular formula : C11H12O3Molecular Weight: 192.21 g/molClassification : MedChemExpress Products > Controlled Products > Piperonyl acetoneDescription: Piperonyl acetone is…
Valemetostat tosylate
Product Name : Valemetostat tosylateSynonym : Chemical Name : CAS NO.: 1809336-93-3Molecular formula : C33H42ClN3O7SMolecular Weight: 660.2 g/molClassification : MedChemExpress Products > Life Sciences > Valemetostat tosylateDescription: Valemetostat is a…
1-Naphthohydroxamic Acid
Product Name : 1-Naphthohydroxamic AcidSynonym : Chemical Name : CAS NO.: 6953-61-3Molecular formula : C11H9NO2Molecular Weight: 187.2 g/molClassification : MedChemExpress Products > Research Chemicals > 1-Naphthohydroxamic AcidDescription: 1-Naphthohydroxamic Acid is…
6-Phosphogluconic acid barium hydrate
Product Name : 6-Phosphogluconic acid barium hydrateSynonym : Chemical Name : CAS NO.: 921-62-0Molecular formula : C6H13O10PMolecular Weight: 276.14 g/molClassification : MedChemExpress Products > Research Chemicals > 6-Phosphogluconic acid barium…
Capecitabine 2′,3′-cyclic carbonate
Product Name : Capecitabine 2',3'-cyclic carbonateSynonym : 5'-Deoxy-5-fluoro-N-cytidine cyclic 2',3'-carbonateCapecitabine EP Impurity FUSP Capecitabine Related Compoun d CChemical Name : CAS NO.: 921769-65-5Molecular formula : C16H20FN3O7Molecular Weight: 385.34 g/molClassification :…
Leu-Gly-OH
Product Name : Leu-Gly-OHSynonym : L-Leucyl-glycineChemical Name : CAS NO.: 686-50-0Molecular formula : C8H16N2O3Molecular Weight: 188.22 g/molClassification : MedChemExpress Products > Research Chemicals > Leu-Gly-OHDescription: Leu-Gly-OH is a compound that…
Neomycin B
Product Name : Neomycin BSynonym : Chemical Name : CAS NO.: 119-04-0Molecular formula : C23H46N6O13Molecular Weight: 614.64 g/molClassification : MedChemExpress Products > Antimicrobials > Antibiotics > Neomycin BDescription: Neomycin is…
Coronalolide
Product Name : CoronalolideSynonym : Chemical Name : CAS NO.: 268214-51-3Molecular formula : C30H42O5Molecular Weight: 482.6 g/molClassification : MedChemExpress Products > Natural Products > CoronalolideDescription: Coronalolide is a rubiaceous plant…
Droxicainide
Product Name : DroxicainideSynonym : Chemical Name : CAS NO.: 78289-26-6Molecular formula : C16H24N2O2Molecular Weight: 276.37 g/molClassification : MedChemExpress Products > Life Sciences > DroxicainideDescription: Droxicainide is a fatty acid…
DIPSO sodium salt
Product Name : DIPSO sodium saltSynonym : Chemical Name : CAS NO.: 102783-62-0Molecular formula : C7H16NNaO6SMolecular Weight: 265.26 g/molClassification : MedChemExpress Products > Research Chemicals > DIPSO sodium saltDescription: DIPSO…
Cellooctaose
Product Name : CellooctaoseSynonym : Chemical Name : CAS NO.: 120434-20-0Molecular formula : C48H82O41Molecular Weight: 1,315.14 g/molClassification : MedChemExpress Products > Carbohydrates > Oligosaccharides > CellooctaoseDescription: Cellooctaose is a synthetic,…
AZD1390
Product Name : AZD1390Synonym : Chemical Name : CAS NO.: 2089288-03-7Molecular formula : C27H32FN5O2Molecular Weight: 477.57 g/molClassification : MedChemExpress Products > Life Sciences > AZD1390Description: AZD1390 is a positron-emitting drug…
Cirsilineol
Product Name : CirsilineolDescription:Cirsilineol, a natural flavone compound, selectively inhibits IFN-γ/STAT1/T-bet signaling in intestinal CD4+ T cells. Cirsilineol has potent immunosuppressive and anti-tumor properties. Cirsilineol significantly ameliorates trinitro-benzene sulfonic acid…
L-Leucine benzyl ester 4-toluenesulfonate salt
Product Name : L-Leucine benzyl ester 4-toluenesulfonate saltSynonym : L-Leu-OBzl·TosOHChemical Name : CAS NO.: 1738-77-8Molecular formula : C13H19NO2·C7H8O3SMolecular Weight: 393.5 g/molClassification : MedChemExpress Products > Research Chemicals > L-Leucine benzyl…
N-Cbz-D-tyrosine
Product Name : N-Cbz-D-tyrosineSynonym : Z-D-Tyr-OHChemical Name : CAS NO.: 64205-12-5Molecular formula : C17H17NO5Molecular Weight: 315.32 g/molClassification : MedChemExpress Products > Research Chemicals > N-Cbz-D-tyrosineDescription: N-Cbz-D-tyrosine (Cbz-D-tyrosine) is an amino…
Nuciferine – Bio-X ™
Product Name : Nuciferine - Bio-X ™Synonym : Chemical Name : CAS NO.: 475-83-2Molecular formula : C19H21NO2Molecular Weight: 295.38 g/molClassification : MedChemExpress Products > Natural Products > Nuciferine - Bio-X…
Rosuvastatin D3
Product Name : Rosuvastatin D3Description:Rosuvastatin D3 (ZD 4522 D3) is a deuterium labeled Rosuvastatin. Rosuvastatin (ZD 4522) is a competitive HMG-CoA reductase inhibitor with an IC50 of 11 nM. Rosuvastatin…
Meliasendanin D
Product Name : Meliasendanin DSynonym : Chemical Name : CAS NO.: 1820034-05-6Molecular formula : C20H24O8Molecular Weight: 392.40 g/molClassification : MedChemExpress Products > Natural Products > Meliasendanin DDescription: Meliasendanin D is…
3-O-Hexadecyl-sn-glycerol
Product Name : 3-O-Hexadecyl-sn-glycerolSynonym : Chemical Name : CAS NO.: 10550-58-0Molecular formula : C19H40O3Molecular Weight: 316.52 g/molClassification : MedChemExpress Products > Life Sciences > Peptides and Biochemicals > Research Peptides…
Glycolic acid oxidase inhibitor 1
Product Name : Glycolic acid oxidase inhibitor 1Synonym : Chemical Name : CAS NO.: 77529-42-1Molecular formula : C16H10BrNO3Molecular Weight: 344.16 g/molClassification : MedChemExpress Products > Life Sciences > Glycolic acid…
NHS-Modified MMAF
Product Name : NHS-Modified MMAFDescription:NHS-Modified MMAF (WO2012143499A2, intermediat 210) is an intermediate which can be used for producing the anti-mesothelin binder-drug conjugates (ADCs).CAS: 1404073-10-4Molecular Weight:1051.32Formula: C55H86N8O12Chemical Name: 2, 5-dioxopyrrolidin-1-yl (3R,…
BAM-22P
Product Name : BAM-22PSynonym : Chemical Name : CAS NO.: 76622-26-9Molecular formula : C130H184N38O31S2Molecular Weight: 2,839.22 g/molClassification : MedChemExpress Products > Research Chemicals > BAM-22PDescription: BAM-22P is a molecule that…
Futoquinol
Product Name : FutoquinolSynonym : Chemical Name : CAS NO.: 28178-92-9Molecular formula : C21H22O5Molecular Weight: 354.4 g/molClassification : MedChemExpress Products > Natural Products > FutoquinolDescription: Futoquinol is a natural product…
Sevirumab
Product Name : SevirumabSynonym : Chemical Name : CAS NO.: 138660-96-5Molecular formula : Molecular Weight: Classification : MedChemExpress Products > Life Sciences > Antibodies > Monoclonal Antibodies > SevirumabDescription: Anti-CMV…
2′-Deoxycytidine
Product Name : 2'-DeoxycytidineDescription:2'-Deoxycytidine, a deoxyribonucleoside, could inhibit biological effects of Bromodeoxyuridine (Brdu).CAS: 951-77-9Molecular Weight:227.22Formula: C9H13N3O4Chemical Name: 4-amino-1--1,2-dihydropyrimidin-2-oneSmiles : NC1C=CN(2C(O)(CO)O2)C(=O)N=1InChiKey: CKTSBUTUHBMZGZ-SHYZEUOFSA-NInChi : InChI=1S/C9H13N3O4/c10-7-1-2-12(9(15)11-7)8-3-5(14)6(4-13)16-8/h1-2,5-6,8,13-14H,3-4H2,(H2,10,11,15)/t5-,6+,8+/m0/s1Purity: ≥98% (or refer to the Certificate of…
Soporidine
Product Name : SoporidineSynonym : Chemical Name : CAS NO.: 1060376-43-3Molecular formula : C27H30F3NO3Molecular Weight: 473.5 g/molClassification : MedChemExpress Products > Life Sciences > SoporidineDescription: Soporidine is an inhibitor of…
D-3,5-Dibromotyrosine
Product Name : D-3,5-DibromotyrosineSynonym : 3,5-Dibromo-D-Tyr-OHChemical Name : CAS NO.: 50299-42-8Molecular formula : C9H9Br2NO3Molecular Weight: 338.98 g/molClassification : MedChemExpress Products > Research Chemicals > D-3,5-DibromotyrosineDescription: D-3,5-Dibromotyrosine is a chemical compound…
8-Bromoguanosine 3′,5′-cyclic monophosphate sodium salt
Product Name : 8-Bromoguanosine 3',5'-cyclic monophosphate sodium saltSynonym : 8-Br-cGMP8-Bromo-D-guanosine-3',5'-cyclic monophosphate sodium saltChemical Name : CAS NO.: 51116-01-9Molecular formula : C10H10BrN5NaO7PMolecular Weight: 446.08 g/molClassification : MedChemExpress Products > Nucleosides >…
5′-O-DMT-PAC-dA
Product Name : 5'-O-DMT-PAC-dADescription:5'-O-DMT-PAC-dA can be used in the synthesis of oligoribonucleotides.CAS: 110522-82-2Molecular Weight:687.74Formula: C39H37N5O7Chemical Name: N-{9-methyl}-4-hydroxyoxolan-2-yl]-9H-purin-6-yl}-2-phenoxyacetamideSmiles : COC1C=CC(=CC=1)C(OC1O(C1O)N1C=NC2C1=NC=NC=2NC(=O)COC1C=CC=CC=1)(C1C=CC=CC=1)C1C=CC(=CC=1)OCInChiKey: JDJUQANHKJNEFT-VUHKNJSWSA-NInChi : InChI=1S/C39H37N5O7/c1-47-29-17-13-27(14-18-29)39(26-9-5-3-6-10-26,28-15-19-30(48-2)20-16-28)50-22-33-32(45)21-35(51-33)44-25-42-36-37(40-24-41-38(36)44)43-34(46)23-49-31-11-7-4-8-12-31/h3-20,24-25,32-33,35,45H,21-23H2,1-2H3,(H,40,41,43,46)/t32-,33+,35+/m0/s1Purity: ≥98% (or refer to the Certificate of Analysis)Shipping…
12-Deoxywithastramonolide
Product Name : 12-DeoxywithastramonolideDescription:12-Deoxywithastramonolide is a principle bioactive compound found in ashwagandha (W. somnifera). 12-Deoxywithastramonolide possesses antioxidant and enzyme inhibitory effects.CAS: 60124-17-6Molecular Weight:470.60Formula: C28H38O6Chemical Name: (1S,2S,4S,5R,10R,11S,14R,15R,18S)-5-hydroxy-15-ethyl]-10,14-dimethyl-3-oxapentacyclooctadec-7-en-9-oneSmiles : CC1C(OC(=O)C=1CO)(C)1CC234O44(O)CC=CC(=O)4(C)3CC12CInChiKey: AWVMHXZWAKRDGG-MEBIVHGNSA-NInChi :…
2′,3′-Cyclic guanosine monophosphate-adenosine monophosphate
Product Name : 2',3'-Cyclic guanosine monophosphate-adenosine monophosphateSynonym : cGAMP2',3'-cyclic GMP-AMPChemical Name : CAS NO.: 1441190-66-4Molecular formula : C20H24N10O13P2Molecular Weight: 674.41 g/molClassification : MedChemExpress Products > Nucleosides > 2',3'-Cyclic guanosine monophosphate-adenosine…
ZL006
Product Name : ZL006Synonym : Chemical Name : CAS NO.: 1181226-02-7Molecular formula : C14H11Cl2NO4Molecular Weight: 328.15 g/molClassification : MedChemExpress Products > Life Sciences > ZL006Description: ZL006 is a potential drug…
FK-448
Product Name : FK-448Synonym : Chemical Name : CAS NO.: 85858-76-0Molecular formula : C25H30N2O3Molecular Weight: 406.5 g/molClassification : MedChemExpress Products > Life Sciences > FK-448Description: FK-448 is an inhibitor of…
Bis(dihydrochelerythrinyl)amine
Product Name : Bis(dihydrochelerythrinyl)amineDescription:Bis(dihydrochelerythrinyl)amine possesses anti-bacteria activity.CAS: 165393-48-6Molecular Weight:711.76Formula: C42H37N3O8Chemical Name: N-{17,18-dimethoxy-21-methyl-5,7-dioxa-21-azapentacyclohenicosa-1,3,8,10,12,14,16,18-octaen-20-yl}-17,18-dimethoxy-21-methyl-5,7-dioxa-21-azapentacyclohenicosa-1,3,8,10,12,14,16,18-octaen-20-amineSmiles : CN1C(NC2C3=C(OC)C(=CC=C3C3=CC=C4C=C5OCOC5=CC4=C3N2C)OC)C2=C(OC)C(=CC=C2C2=CC=C3C=C4OCOC4=CC3=C12)OCInChiKey: OZEFMOJRNJPFRQ-UHFFFAOYSA-NInChi : InChI=1S/C42H37N3O8/c1-44-37-25(9-7-21-15-31-33(17-27(21)37)52-19-50-31)23-11-13-29(46-3)39(48-5)35(23)41(44)43-42-36-24(12-14-30(47-4)40(36)49-6)26-10-8-22-16-32-34(53-20-51-32)18-28(22)38(26)45(42)2/h7-18,41-43H,19-20H2,1-6H3Purity: ≥98% (or refer to the Certificate of Analysis)Shipping Condition: Shipped under ambient temperature…
TRAM-34
Product Name : TRAM-34Description:TRAM-34 is a highly selective blocker of intermediate conductance Ca2+-activated K+ channels (KCa3.1) that has been shown to suppress the reactivation of lymphocytes by mitogenic stimuli without…
Triclopyricarb-d6
Product Name : Triclopyricarb-d6Synonym : Chemical Name : CAS NO.: 902760-40-1Molecular formula : C15H13Cl3N2O4Molecular Weight: 391.6 g/molClassification : MedChemExpress Products > Research Chemicals > Triclopyricarb-d6Description: Triclopyricarb-d6 is a pesticide that…
T-26c
Product Name : T-26cSynonym : Chemical Name : CAS NO.: 869296-13-9Molecular formula : C24H21N3O6SMolecular Weight: 479.51 g/molClassification : MedChemExpress Products > Life Sciences > T-26cDescription: T-26c is a peptide that…
3-Amino-5-methylisoxazole
Product Name : 3-Amino-5-methylisoxazoleSynonym : 5-Methyl-3-isoxazolamine5-Methyl-1,2-oxazol-3-amine5-Methyl-3-aminoisoxazoleChemical Name : CAS NO.: 1072-67-9Molecular formula : C4H6N2OMolecular Weight: 98.1 g/molClassification : MedChemExpress Products > Research Chemicals >Fine Chemicals > 3-Amino-5-methylisoxazoleDescription: 3-Amino-5-methylisoxazole is a…
MS 154
Product Name : MS 154Description:MS 154 is a potent and selective cereblon-recruiting Degrader (PROTAC®) of mutant epidermal growth factor receptor (EGFR), comprising a cereblon-binding moiety joined by a linker to…
Palomid 529 (P529)
Product Name : Palomid 529 (P529)Description:Palomid 529, also known as P529, is a novel PI3K/Akt/mTOR inhibitor. Palomid 529 (P529) inhibits the TORC1 and TORC2 complexes and shows both inhibition of…
N3-PEG2-C2-PFP ester
Product Name : N3-PEG2-C2-PFP esterSynonym : Chemical Name : CAS NO.: 1393330-37-4Molecular formula : Molecular Weight: Classification : MedChemExpress Products > Research Chemicals > N3-PEG2-C2-PFP esterDescription: N3-PEG2-C2-PFP ester is a…
PF-04418948
Product Name : PF-04418948Synonym : Chemical Name : CAS NO.: 1078166-57-0Molecular formula : C23H20FNO5Molecular Weight: 409.41 g/molClassification : MedChemExpress Products > Life Sciences > PF-04418948Description: PF-04418948 is a potent and…
Glabrescione B
Product Name : Glabrescione BSynonym : Chemical Name : CAS NO.: 65893-94-9Molecular formula : C27H30O6Molecular Weight: 450.5 g/molClassification : MedChemExpress Products > Life Sciences > Glabrescione BDescription: Glabrescione B is…
KU-0063794
Product Name : KU-0063794Description:KU-0063794 is a potent and selective mTOT inhibitor, which inhibits both mTORC1 and mTORC2 with an IC50 of approximately 10 nM, but does not suppress the activity…
Deserpidine
Product Name : DeserpidineSynonym : Chemical Name : CAS NO.: 131-01-1Molecular formula : C32H38N2O8Molecular Weight: 578.65 g/molClassification : MedChemExpress Products > Research Chemicals > DeserpidineDescription: Deserpidine is a hydroxyl group-containing…
S-Butyrylthiocholine iodide
Product Name : S-Butyrylthiocholine iodideSynonym : 2-(Mercaptoethyl)trimethylammonium iodide butyrateChemical Name : CAS NO.: 1866-16-6Molecular formula : C9H20INOSMolecular Weight: 317.23 g/molClassification : MedChemExpress Products > Research Chemicals > S-Butyrylthiocholine iodideDescription: Chromogenic…
Pseudoerythromycin A enol ether
Product Name : Pseudoerythromycin A enol etherSynonym : Chemical Name : CAS NO.: 105882-69-7Molecular formula : C37H65NO12Molecular Weight: 715.91 g/molClassification : MedChemExpress Products > Research Chemicals > Pseudoerythromycin A enol…
Dazoxiben HCl
Product Name : Dazoxiben HClDescription:Dazoxiben hydrochloride is a potent, orally active thromboxane (TX) synthase inhibitor that reduces the formation of blood clots.CAS: 74226-22-5Molecular Weight:268.70Formula: C12H13ClN2O3Chemical Name: 4-(2-(1H-Imidazol-1-yl)ethoxy)benzoic acid hydrochlorideSmiles :…
4-[[2-[(4-chlorophenyl)methyl-(2,3,4,5,6-pentafluorophenyl)sulfonylamino]acetyl]-[(3,5-ditert-butylphenyl)methyl]amino]benzoic acid
Product Name : 4-acetyl]-amino]benzoic acidSynonym : Chemical Name : CAS NO.: 1834571-82-2Molecular formula : C37H36ClF5N2O5SMolecular Weight: 751.2 g/molClassification : MedChemExpress Products > Life Sciences > 4-acetyl]-amino]benzoic acidDescription: 4-acetyl]-amino]benzoic acid is…
A-803467
Product Name : A-803467Synonym : Chemical Name : CAS NO.: 944261-79-4Molecular formula : C19H16ClNO4Molecular Weight: 357.79 g/molClassification : MedChemExpress Products > Research Chemicals > A-803467Description: A-803467 is a novel amide…
Biorobin
Product Name : BiorobinSynonym : Chemical Name : CAS NO.: 17297-56-2Molecular formula : C27H30O15Molecular Weight: 594.5 g/molClassification : MedChemExpress Products > Natural Products > BiorobinDescription: Biorobin is a dietary supplement…
Saracatinib
Product Name : SaracatinibDescription:Saracatinib, also known as AZD0530, is an orally available dual-specific inhibitor of Src and Abl with anti-invasive and anti-tumor activities. Src and Abl are protein tyrosine kinases…
²-Glutamic acid
Product Name : ²-Glutamic acidSynonym : Chemical Name : CAS NO.: 1948-48-7Molecular formula : C5H9NO4Molecular Weight: 147.13 g/molClassification : MedChemExpress Products > Research Chemicals > ²-Glutamic acidDescription: ²-Glutamic acid is…
TC 2559 Fumarate
Product Name : TC 2559 FumarateSynonym : Chemical Name : CAS NO.: 212332-35-9Molecular formula : C12H18N2O•(C4H4O4)xMolecular Weight: 206.28 g/molClassification : MedChemExpress Products > Life Sciences > TC 2559 FumarateDescription: TC…
m-PEG8-Ms
Product Name : m-PEG8-MsSynonym : Chemical Name : CAS NO.: 477775-57-8Molecular formula : C16H34O10SMolecular Weight: 418.5 g/molClassification : MedChemExpress Products > Research Chemicals > m-PEG8-MsDescription: m-PEG8-Ms is a heterobifunctional PEG…
SJA710-6
Product Name : SJA710-6Description:SJA710-6 is a Hepatic Differentiation Inducer which is able to induce the differentiation of rat MSCs (rMSCs) toward hepatocyte-like cells in vitro, where rMSCs treated with SJA710-6…
1-(Pyridin-4-yl)-3-(quinolin-2-yl)prop-2-en-1-one
Product Name : 1-(Pyridin-4-yl)-3-(quinolin-2-yl)prop-2-en-1-oneSynonym : Chemical Name : CAS NO.: 4382-63-2Molecular formula : C17H12N2OMolecular Weight: 260.3 g/molClassification : MedChemExpress Products > Research Chemicals > 1-(Pyridin-4-yl)-3-(quinolin-2-yl)prop-2-en-1-oneDescription: 1-(Pyridin-4-yl)-3-(quinolin-2-yl)prop-2-en-1-one is a small molecule…
Dehydromiltirone
Product Name : DehydromiltironeSynonym : 7,8-Dihydro-2-isopropyl-8,8-dimethylphenanthrene-3,4-dioneChemical Name : CAS NO.: 116064-77-8Molecular formula : C19H20O2Molecular Weight: 280.36 g/molClassification : MedChemExpress Products > Research Chemicals > DehydromiltironeDescription: Dehydromiltirone is a growth factor…
AzaphenHydrochloride
Product Name : AzaphenHydrochlorideSynonym : Chemical Name : CAS NO.: 24853-80-3Molecular formula : C16H21Cl2N5OMolecular Weight: 370.28 g/molClassification : MedChemExpress Products > Research Chemicals >Fine Chemicals > AzaphenHydrochlorideDescription: AzaphenHydrochloride is a…
NIBR3049
Product Name : NIBR3049Description:NIBR3049, also known as TCS-21311, is a potent and selective JAK3 inhibitor IC50 values of 8 nM..CAS: 1260181-14-3Molecular Weight:526.51Formula: C27H25F3N4O4Chemical Name: 3--2-(trifluoromethyl)phenyl]-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dioneSmiles : CC(C)(O)C(=O)N1CCN(CC1)C1=CC(C2=C(C3=CNC4=CC=CC=C43)C(=O)NC2=O)=C(C=C1)C(F)(F)FInChiKey: CLGRAWDGLMENOD-UHFFFAOYSA-NInChi : InChI=1S/C27H25F3N4O4/c1-26(2,38)25(37)34-11-9-33(10-12-34)15-7-8-19(27(28,29)30)17(13-15)21-22(24(36)32-23(21)35)18-14-31-20-6-4-3-5-16(18)20/h3-8,13-14,31,38H,9-12H2,1-2H3,(H,32,35,36)Purity:…
BI-78D3
Product Name : BI-78D3Description:BI-78D3, also known as JNK Inhibitor X, is a potent JNK inhibitor. BI-78D3 dose-dependently inhibits the phosphorylation of JNK substrates both in vitro and in cell. BI-78D3…
Epitheaflagallin 3-o-gallate
Product Name : Epitheaflagallin 3-o-gallateSynonym : Chemical Name : CAS NO.: 102067-92-5Molecular formula : C27H20O13Molecular Weight: 552.4 g/molClassification : MedChemExpress Products > Natural Products > Epitheaflagallin 3-o-gallateDescription: Epitheaflagallin 3-o-gallate is…
5′-O-DMT-2′-O-methyl-5-methyluridine 3′-CE phosphoramidite
Product Name : 5'-O-DMT-2'-O-methyl-5-methyluridine 3'-CE phosphoramiditeSynonym : 5'-O-DMT-2'-O-methyl-5-methyl-D-uridine 3'-CE phosphoramidite2'-O-Methyl-5-methyl-U CEPChemical Name : CAS NO.: 153631-20-0Molecular formula : C41H51N4O9PMolecular Weight: 774.86 g/molClassification : MedChemExpress Products > Nucleosides > Phosphoramidites >…
Ganetespib
Product Name : GanetespibSynonym : STA 9090Chemical Name : CAS NO.: 888216-25-9Molecular formula : C20H20N4O3Molecular Weight: 364.4 g/molClassification : MedChemExpress Products > Life Sciences > Ligands > Protein Interactions >…
SB-3CT
Product Name : SB-3CTDescription:SB-3CT is a potent matrix metalloproteinase MMP-2 and MMP-9 inhibitor. SB-3CT is a 2-thiirane that achieves potent inhibition, by a thiirane-opening mechanism, of the MMP2 and MMP9…
Melanin
Product Name : MelaninSynonym : Chemical Name : CAS NO.: 8049-97-6Molecular formula : C18H10N2O4Molecular Weight: 318.28 g/molClassification : MedChemExpress Products > Natural Products > MelaninDescription: Melanin is a substance that…
Ac-Arg-Gly-Lys(Ac)-MCA
Product Name : Ac-Arg-Gly-Lys(Ac)-MCASynonym : Chemical Name : CAS NO.: 660846-97-9Molecular formula : C28H40N8O7Molecular Weight: 600.68 g/molClassification : MedChemExpress Products > Life Sciences > Ac-Arg-Gly-Lys(Ac)-MCADescription: Ac-Arg-Gly-Lys(Ac)-MCA is a peptide that…
Angiotensin II Antipeptide
Product Name : Angiotensin II AntipeptideSynonym : H-Glu-Gly-Val-Tyr-Val-His-Pro-Val-OH H-EGVYVHPV-OHChemical Name : CAS NO.: 121379-63-3Molecular formula : C42H62N10O12Molecular Weight: 899 g/molClassification : MedChemExpress Products > Research Chemicals > Angiotensin II AntipeptideDescription:…
AG-221 (Enasidenib), IHD2 Inhibitor
Product Name : AG-221 (Enasidenib), IHD2 InhibitorDescription:Enasidenib, also known as AG-221 and CC-90007, is a potent and selective IDH2 inhibitor with potential anticancer activity (IDH2 = Isocitrate dehydrogenase 2). The…
prim-O-glucosylangelicain
Product Name : prim-O-glucosylangelicainSynonym : Chemical Name : CAS NO.: 85889-15-2Molecular formula : Molecular Weight: Classification : MedChemExpress Products > Carbohydrates > Monosaccharides > prim-O-glucosylangelicainDescription: Prim-O-glucosylangelicain is a complex carbohydrate…
trans,cis-2,6-Nonadienal
Product Name : trans,cis-2,6-NonadienalSynonym : Chemical Name : CAS NO.: 557-48-2Molecular formula : C9H14OMolecular Weight: 138.21 g/molClassification : MedChemExpress Products > Research Chemicals > trans,cis-2,6-NonadienalDescription: Trans,cis-2,6-Nonadienal is a fatty acid…
Bax-activator-106
Product Name : Bax-activator-106Synonym : Chemical Name : CAS NO.: 1638526-94-9Molecular formula : C29H36N4O3Molecular Weight: 488.6 g/molClassification : MedChemExpress Products > Life Sciences > Bax-activator-106Description: Bax-activator-106 is a peptide that…
CASIN — Cdc42 Inhibitor
Product Name : CASIN --- Cdc42 InhibitorDescription:CASIN is a novel and potent Cdc42 inhibitor with an IC50 ~2 µM. In a recent publication in Cell Stem Cell, the elevated activity…
Fmoc-O-benzyl-L-serine
Product Name : Fmoc-O-benzyl-L-serineSynonym : Fmoc-L-Ser(Bzl)-OHChemical Name : CAS NO.: 83792-48-7Molecular formula : C25H23NO5Molecular Weight: 417.45 g/molClassification : MedChemExpress Products > Research Chemicals > Fmoc-O-benzyl-L-serineDescription: Fmoc-O-benzyl-L-serine is a synthetic amino…
Ceftezole
Product Name : CeftezoleSynonym : Chemical Name : CAS NO.: 26973-24-0Molecular formula : C13H12N8O4S3Molecular Weight: 440.48 g/molClassification : MedChemExpress Products > Research Chemicals > CeftezoleDescription: Ceftezole is a cephalosporin antibiotic…
PF-06459988
Product Name : PF-06459988Synonym : Chemical Name : CAS NO.: 1428774-45-1Molecular formula : C19H22ClN7O3Molecular Weight: 431.88 g/molClassification : MedChemExpress Products > Life Sciences > PF-06459988Description: PF-06459988 is a potent and…
Afoxolaner
Product Name : AfoxolanerDescription:Afoxolaner is an orally active isoxazoline insecticide/acaricide against Ixodes scapularis in dogs. Afoxolaner acts on the insect γ-aminobutyric acid receptor (GABA) and glutamate receptors, inhibiting GABA &…
Z-Gly-Gly-Arg-AMC
Product Name : Z-Gly-Gly-Arg-AMCDescription:Z-Gly-Gly-Arg-AMC is a thrombin-specific fluorogenic substrate for testing of thrombin generation in PRP and platelet-poor plasma (PPP).CAS: 66216-78-2Molecular Weight:579.60Formula: C28H33N7O7Chemical Name: benzyl N-{-2-pentanoyl]carbamoyl}methyl)carbamoyl]methyl}carbamateSmiles : CC1=CC(=O)OC2=CC(=CC=C21)N(CCCN=C(N)N)C(=O)NC(=O)CNC(=O)CNC(=O)OCC1C=CC=CC=1InChiKey: YXLGWNWVIGXGME-NRFANRHFSA-NInChi :…
LY2140023
Product Name : LY2140023Synonym : pomaglumetad methionilChemical Name : CAS NO.: 635318-55-7Molecular formula : C12H18N2O7S2Molecular Weight: 366.41 g/molClassification : MedChemExpress Products > Life Sciences > LY2140023Description: LY2140023 is a novel…
Nedocromil sodium
Product Name : Nedocromil sodiumSynonym : Chemical Name : CAS NO.: 69049-74-7Molecular formula : C19H15NNa2O7Molecular Weight: 415.3 g/molClassification : MedChemExpress Products > Research Chemicals > Nedocromil sodiumDescription: Nedocromil sodium is…
Topramezone
Product Name : TopramezoneSynonym : Chemical Name : CAS NO.: 210631-68-8Molecular formula : C16H17N3O5SMolecular Weight: 363.39 g/molClassification : MedChemExpress Products > Research Chemicals > TopramezoneDescription: Topramezone is a herbicide that…
Swertisin
Product Name : SwertisinDescription:Swertisin, a C-glucosylflavone isolated from Swertia japonica, is known to have antidiabetic, anti-inflammatory and antioxidant effects. Swertisin is an adenosine A1 receptor antagonist.CAS: 6991-10-2Molecular Weight:446.40Formula: C22H22O10Chemical Name:…
SR 11302
Product Name : SR 11302Synonym : Chemical Name : CAS NO.: 160162-42-5Molecular formula : C26H32O2Molecular Weight: 376.54 g/molClassification : MedChemExpress Products > Research Chemicals > SR 11302Description: SR 11302 is…
Zinc stearate
Product Name : Zinc stearateSynonym : Chemical Name : CAS NO.: 557-05-1Molecular formula : C36H70O4ZnMolecular Weight: 632.32 g/molClassification : MedChemExpress Products > Research Chemicals > Zinc stearateDescription: Zinc stearate is…
6-Hydroxyflavone
Product Name : 6-HydroxyflavoneSynonym : Chemical Name : CAS NO.: 6665-83-4Molecular formula : C15H10O3Molecular Weight: 238.24 g/molClassification : MedChemExpress Products > Natural Products > Flavonoids > Flavones and Isoflavones >…
Bongkrekic acid
Product Name : Bongkrekic acidDescription:Bongkrekic acid is a mitochondrial toxin secreted by the bacteria Pseudomonas cocovenenans. Bongkrekic acid specific ligand for mitochondrial adenine nucleotide translocase (ANT) rather than the electron…
1-Deoxy-L-threo-sphinganine-d3
Product Name : 1-Deoxy-L-threo-sphinganine-d3Synonym : Chemical Name : CAS NO.: 1246298-32-7Molecular formula : C18H36D3NOMolecular Weight: 288.53 g/molClassification : MedChemExpress Products > Life Sciences > Ligands > 1-Deoxy-L-threo-sphinganine-d3Description: 1-Deoxy-L-threo-sphinganine-d3 is a…
Methyl-β-cyclodextrin – 7 to 14 degree of substitution
Product Name : Methyl-β-cyclodextrin - 7 to 14 degree of substitutionSynonym : Chemical Name : CAS NO.: 128446-36-6Molecular formula : C56H98O35Molecular Weight: 1,331.36 g/molClassification : MedChemExpress Products > Carbohydrates >…
t-Boc-N-amido-PEG1-NHS ester
Product Name : t-Boc-N-amido-PEG1-NHS esterSynonym : Chemical Name : CAS NO.: 1260092-55-4Molecular formula : C14H22N2O7Molecular Weight: 330.34 g/molClassification : MedChemExpress Products > PEG Polymers > t-Boc-N-amido-PEG1-NHS esterDescription: t-Boc-N-amido-PEG1-NHS ester is…
EGFR-IN-1
Product Name : EGFR-IN-1Description:EGFR-IN-1 (compound 24) is an orally active and irreversible L858R/T790M mutant selective EGFR inhibitor. EGFR-IN-1 potently inhibits Gefitinib-resistant EGFR L858R, T790M with 100-fold selectivity over wild-type EGFR.…
VUF 11207 fumarate
Product Name : VUF 11207 fumarateSynonym : Chemical Name : CAS NO.: 1785665-61-3Molecular formula : C31H39FN2O8Molecular Weight: 586.6 g/molClassification : MedChemExpress Products > Life Sciences > VUF 11207 fumarateDescription: VUF…
2-Cyanoadenosine
Product Name : 2-CyanoadenosineSynonym : Chemical Name : CAS NO.: 79936-11-1Molecular formula : Molecular Weight: Classification : MedChemExpress Products > Nucleosides > 2-CyanoadenosineDescription: 2-Cyanoadenosine is a derivative of adenosine. It…
D-α-Tocopherolquinone
Product Name : D-α-TocopherolquinoneSynonym : Chemical Name : CAS NO.: 7559-04-8Molecular formula : C29H50O3Molecular Weight: 446.71 g/molClassification : MedChemExpress Products > Research Chemicals > D-α-TocopherolquinoneDescription: D-a-Tocopherolquinone is a useful building…
Eupalinolide B
Product Name : Eupalinolide BDescription:Eupalinolide B is a germacrane sesquiterpene isolated from Eupatorium lindleyanum. Eupalinolide B demonstrates potent cytotoxicity against A-549, BGC-823 and HL-60 tumour cell lines.CAS: 877822-41-8Molecular Weight:462.49Formula: C24H30O9Chemical…
JHU37160
Product Name : JHU37160Synonym : Chemical Name : CAS NO.: 2369979-68-8Molecular formula : C19H20ClFN4Molecular Weight: 358.8 g/molClassification : MedChemExpress Products > Life Sciences > JHU37160Description: JHU37160 is an inhibitor that…
(2R,3S)-E1R
Product Name : (2R,3S)-E1RSynonym : Chemical Name : CAS NO.: 1424832-60-9Molecular formula : C13H16N2O2Molecular Weight: 232.28 g/molClassification : MedChemExpress Products > Life Sciences > Ligands > (2R,3S)-E1RDescription: (2R,3S)-E1R is a…
Glycerol triacetate
Product Name : Glycerol triacetateSynonym : TriacetinChemical Name : CAS NO.: 102-76-1Molecular formula : C9H14O6Molecular Weight: 218.2 g/molClassification : MedChemExpress Products > Research Chemicals > Glycerol triacetateDescription: Glycerol triacetate is…
Hydroxy-PEG1-C2-methyl ester
Product Name : Hydroxy-PEG1-C2-methyl esterDescription:Hydroxy-PEG1-C2-methyl ester is a PEG-based PROTAC linker that can be used in the synthesis of PROTACs.CAS: 93673-82-6Molecular Weight:148.16Formula: C6H12O4Chemical Name: methyl 3-(2-hydroxyethoxy)propanoateSmiles : COC(=O)CCOCCOInChiKey: CQAKPCZOXXRLJA-UHFFFAOYSA-NInChi :…
YM17E
Product Name : YM17ESynonym : Chemical Name : CAS NO.: 124900-72-7Molecular formula : C40H56N6O2Molecular Weight: 652.9 g/molClassification : MedChemExpress Products > Life Sciences > Ligands > YM17EDescription: YM17E is a…
(2-Isopropylphenyl)boronic acid
Product Name : (2-Isopropylphenyl)boronic acidSynonym : Chemical Name : CAS NO.: 89787-12-2Molecular formula : C9H13BO2Molecular Weight: 164.01 g/molClassification : MedChemExpress Products > Research Chemicals > (2-Isopropylphenyl)boronic acidDescription: Boronic acid is…
[[(3,5-Dimethyl-1H-pyrrol-2-yl)(3,5-dimethyl-2H-pyrrol-2-ylidene)methyl]methane](difluoroborane)
Product Name : methane](difluoroborane)Synonym : Pyrromethene 546Chemical Name : CAS NO.: 121207-31-6Molecular formula : C14H17BF2N2Molecular Weight: 262.11 g/molClassification : MedChemExpress Products > Research Chemicals > methane](difluoroborane)Description: methane](difluoroborane) is a compound…
α-Tocopherol-d6 acetate
Product Name : α-Tocopherol-d6 acetateDescription:Product informationCAS: 143731-16-2Molecular Weight:478.78Formula: C31H52O3Chemical Name: (2R)-5,7-di(²H₃)methyl-2,8-dimethyl-2--3,4-dihydro-2H-1-benzopyran-6-yl acetateSmiles : C()()C1=C(OC(C)=O)C(=C(C)C2O(C)(CCC1=2)CCC(C)CCC(C)CCCC(C)C)C()()InChiKey: ZAKOWWREFLAJOT-JALLZHECSA-NInChi : InChI=1S/C31H52O3/c1-21(2)13-10-14-22(3)15-11-16-23(4)17-12-19-31(9)20-18-28-26(7)29(33-27(8)32)24(5)25(6)30(28)34-31/h21-23H,10-20H2,1-9H3/t22-,23-,31-/m1/s1/i5D3,7D3Purity: ≥98% (or refer to the Certificate of Analysis)Shipping Condition: Shipped under ambient temperature…
AGN 193109-d7 Ethyl Ester
Product Name : AGN 193109-d7 Ethyl EsterDescription:Product informationCAS: 1246815-93-9Molecular Weight:427.59Formula: C30H28O2Chemical Name: ethyl 4-(2-{5,5-dimethyl-8--5,6-dihydronaphthalen-2-yl}ethynyl)benzoateSmiles : C()()C1C()=C()C(C2=CCC(C)(C)C3=CC=C(C=C32)C#CC2C=CC(=CC=2)C(=O)OCC)=C()C=1InChiKey: YQBZMGXOWNSVJL-QEKUZJFVSA-NInChi : InChI=1S/C30H28O2/c1-5-32-29(31)25-15-10-22(11-16-25)8-9-23-12-17-28-27(20-23)26(18-19-30(28,3)4)24-13-6-21(2)7-14-24/h6-7,10-18,20H,5,19H2,1-4H3/i2D3,6D,7D,13D,14DPurity: ≥98% (or refer to the Certificate of Analysis)Shipping Condition: Shipped under…
Flurbiprofen
Product Name : FlurbiprofenSynonym : 2-(2-Fluoro-4-biphenylyl)propanoic acid (±)-2-Fluoro-alpha-methyl-4-biphenylacetic acidChemical Name : CAS NO.: 5104-49-4Molecular formula : C15H13FO2Molecular Weight: 244.26 g/molClassification : MedChemExpress Products > Life Sciences > Ligands > Enzyme…
DL-2-Methylglutamic acid hemihydrate
Product Name : DL-2-Methylglutamic acid hemihydrateSynonym : 2-Methyl-Dl-Glutamic AcidChemical Name : CAS NO.: 71-90-9Molecular formula : C6H11NO4·1/2H2OMolecular Weight: 170.16 g/molClassification : MedChemExpress Products > Research Chemicals > DL-2-Methylglutamic acid hemihydrateDescription:…
Lesinurad sodium
Product Name : Lesinurad sodiumSynonym : Chemical Name : CAS NO.: 1151516-14-1Molecular formula : C17H13BrN3O2S·NaMolecular Weight: 426.27 g/molClassification : MedChemExpress Products > Life Sciences > Lesinurad sodiumDescription: Lesinurad sodium is…
Pseudolaric Acid C2
Product Name : Pseudolaric Acid C2Description:Pseudolaric Acid C2, a diterpenoid isolated from Pseudolarix kaempferi, is identified as the specific metabolite of Pseudolaric acid B in plasma, urine, bile and feces…
SNT-207858
Product Name : SNT-207858Synonym : Chemical Name : CAS NO.: 1104080-42-3Molecular formula : C32H45Cl4N5O3Molecular Weight: 689.5 g/molClassification : MedChemExpress Products > Life Sciences > SNT-207858Description: SNT-207858 is an antibody that…
cort-108297
Product Name : cort-108297Synonym : Chemical Name : CAS NO.: 1018679-79-2Molecular formula : C26H25F4N3O3SMolecular Weight: 535.56 g/molClassification : MedChemExpress Products > Research Chemicals > cort-108297Description: Cort-108297 is a glucocorticoid receptor…
Rabdophyllin G
Product Name : Rabdophyllin GSynonym : Chemical Name : CAS NO.: 82460-75-1Molecular formula : C22H30O7Molecular Weight: 406.47 g/molClassification : MedChemExpress Products > Natural Products > Rabdophyllin GDescription: Rabdophyllin G is…
AES-135
Product Name : AES-135Description:AES-135, a hydroxamic acid-based HDAC inhibitor, prolongs survival in an orthotopic mouse model of pancreatic cancer. AES-135 inhibits HDAC3, HDAC6, HDAC8, and HDAC11 with IC50s ranging from…
Sofigatran
Product Name : SofigatranDescription:Sofigatran (MCC-977) is an orally active factor IIa (thrombin) inhibitor, acts as an anticoagulant. Sofigatran is used for the research of cardiovascular disease.CAS: 187602-11-5Molecular Weight:484.70Formula: C24H44N4O4SChemical Name:…
Methyl 2,3,6-tri-O-benzoyl-α-D-galactopyranoside
Product Name : Methyl 2,3,6-tri-O-benzoyl-α-D-galactopyranosideSynonym : Chemical Name : CAS NO.: 3601-36-3Molecular formula : C28H26O9Molecular Weight: 506.5 g/molClassification : MedChemExpress Products > Carbohydrates > Monosaccharides > Methyl 2,3,6-tri-O-benzoyl-α-D-galactopyranosideDescription: Methyl 2,3,6-tri-O-benzoyl-α-D-galactopyranoside…
Acalisib
Product Name : AcalisibSynonym : GS 9820CAL 120Chemical Name : CAS NO.: 870281-34-8Molecular formula : C21H16FN7OMolecular Weight: 401.4 g/molClassification : MedChemExpress Products > Life Sciences > AcalisibDescription: Selective PI3Kδ inhibitorPurity :…
Corn steep liquor – 45% aqueous solution
Product Name : Corn steep liquor - 45% aqueous solutionSynonym : Chemical Name : CAS NO.: 66071-94-1Molecular formula : Molecular Weight: Classification : MedChemExpress Products > Research Chemicals > Corn…
Domoic acid
Product Name : Domoic acidDescription:Domoic acid ((-)-Domoic acid; L-Domoic acid) is an excitatory neurotransmitter isolated from a form of marine vegetation, Nitzschia pungens. Domoic acid produces neurotoxic effect through activating…
Leucomalachite Green-d6
Product Name : Leucomalachite Green-d6Synonym : Chemical Name : CAS NO.: 1173021-13-0Molecular formula : C23H20D6N2Molecular Weight: 336.5 g/molClassification : MedChemExpress Products > Research Chemicals > Leucomalachite Green-d6Description: Leucomalachite Green-d6 is…
Canophyllal
Product Name : CanophyllalSynonym : Chemical Name : CAS NO.: 14440-40-5Molecular formula : C30H48O2Molecular Weight: 440.70 g/molClassification : MedChemExpress Products > Natural Products > CanophyllalDescription: Canophyllal is a natural product…
Isocudraniaxanthone A
Product Name : Isocudraniaxanthone ASynonym : Chemical Name : CAS NO.: 197447-26-0Molecular formula : C18H16O6Molecular Weight: 328.3 g/molClassification : MedChemExpress Products > Natural Products > Isocudraniaxanthone ADescription: Isocudraniaxanthone A (ICA)…
Loracarbef monohydrate
Product Name : Loracarbef monohydrateSynonym : (6R,7S)-7-amino]-3-chloro-8-oxo-1-azabicyclooct-2-ene-2-carboxylic acidLorabidChemical Name : CAS NO.: 76470-66-1Molecular formula : C16H16ClN3O4·H2OMolecular Weight: 367.78 g/molClassification : MedChemExpress Products > Antimicrobials > Antibiotics > Loracarbef monohydrateDescription: Loracarbef…
Nuclear fast red
Product Name : Nuclear fast redSynonym : Chemical Name : CAS NO.: 6409-77-4Molecular formula : C14H8NO7S·NaMolecular Weight: 357.27 g/molClassification : MedChemExpress Products > Research Chemicals > Nuclear fast redDescription: Nuclear…
Octyl glucose neopentyl glycol
Product Name : Octyl glucose neopentyl glycolSynonym : 2,2-Dihexylpropane-1,3-bis b-D-glucopyranosideOctyl MNGChemical Name : CAS NO.: 1257853-32-9Molecular formula : C27H52O12Molecular Weight: 568.69 g/molClassification : MedChemExpress Products > Carbohydrates > Detergents >…
Nonanoic acid
Product Name : Nonanoic acidSynonym : Pelargonic acid 1-Octanecarboxylic acidChemical Name : CAS NO.: 112-05-0Molecular formula : C9H18O2Molecular Weight: 158.24 g/molClassification : MedChemExpress Products > Research Chemicals > Nonanoic acidDescription:…
ACTH (18-39) (human)
Product Name : ACTH (18-39) (human)Synonym : H-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH H-RPVKVYPNGAEDESAEAFPLEF-OHChemical Name : CAS NO.: 53917-42-3Molecular formula : C112H165N27O36Molecular Weight: 2,465.67 g/molClassification : MedChemExpress Products > Research Chemicals > ACTH (18-39) (human)Description:…
Apicidin
Product Name : ApicidinSynonym : CycloCyclo(8-oxo-L-2-aminodecanoyl-1-metho xy-L-tryptophyl-L-isoleucyl-D-2-piperidinecarbonyl)Apicidin iaChemical Name : CAS NO.: 183506-66-3Molecular formula : C34H49N5O6Molecular Weight: 623.78 g/molClassification : MedChemExpress Products > Research Chemicals >Fine Chemicals > ApicidinDescription: Apicidin…
I-Stat (trisodium)
Product Name : I-Stat (trisodium)Synonym : Chemical Name : CAS NO.: 31894-34-5Molecular formula : C10H5Na3O10S3Molecular Weight: 450.3 g/molClassification : MedChemExpress Products > Life Sciences > I-Stat (trisodium)Description: I-Stat (trisodium) is…
Tribenzagan Hydrochloride
Product Name : Tribenzagan HydrochlorideSynonym : Chemical Name : CAS NO.: 554-92-7Molecular formula : C21H28N2O5·HClMolecular Weight: 424.92 g/molClassification : MedChemExpress Products > Research Chemicals > Tribenzagan HydrochlorideDescription: Tribenzagan Hydrochloride is…
Protoplumericin A
Product Name : Protoplumericin ASynonym : Chemical Name : CAS NO.: 80396-57-2Molecular formula : C36H42O19Molecular Weight: 778.7 g/molClassification : MedChemExpress Products > Natural Products > Protoplumericin ADescription: Protoplumericin A is…
Cyclohexane-1,2-dione
Product Name : Cyclohexane-1,2-dioneSynonym : 1,2-CyclohexanedioneChemical Name : CAS NO.: 765-87-7Molecular formula : C6H8O2Molecular Weight: 112.13 g/molClassification : MedChemExpress Products > Research Chemicals > Building Blocks > Cycloalkanes and Cycloalkenes…
L-Norleucine
Product Name : L-NorleucineSynonym : L-2-Aminohexanoic acid (S)-2-Aminocaproic acidChemical Name : CAS NO.: 327-57-1Molecular formula : C6H13NO2Molecular Weight: 131.17 g/molClassification : MedChemExpress Products > Research Chemicals > L-NorleucineDescription: L-Norleucine is…
Fenchlorphos
Product Name : FenchlorphosSynonym : Chemical Name : CAS NO.: 299-84-3Molecular formula : C8H8Cl3O3PSMolecular Weight: 321.55 g/molClassification : MedChemExpress Products > Research Chemicals > FenchlorphosDescription: Fenchlorphos is a pesticide that…
Pomalidomide 4′-alkylC5-acid
Product Name : Pomalidomide 4'-alkylC5-acidSynonym : Chemical Name : CAS NO.: 2225940-49-6Molecular formula : C19H21N3O6Molecular Weight: 387.4 g/molClassification : MedChemExpress Products > Life Sciences > Pomalidomide 4'-alkylC5-acidDescription: Pomalidomide 4'-alkylC5-acid is…
Methylamino-PEG2-acid hydrochloride
Product Name : Methylamino-PEG2-acid hydrochlorideSynonym : Chemical Name : CAS NO.: 1807503-87-2Molecular formula : C8H17NO4Molecular Weight: 191.22 g/molClassification : MedChemExpress Products > PEG Polymers > Methylamino-PEG2-acid hydrochlorideDescription: Methylamino-PEG2-acid hydrochloride is…
NS 11021
Product Name : NS 11021Synonym : Chemical Name : CAS NO.: 956014-19-0Molecular formula : C16H9BrF6N6SMolecular Weight: 511.24 g/molClassification : MedChemExpress Products > Life Sciences > NS 11021Description: NS 11021 is…
Leurosine
Product Name : LeurosineSynonym : Chemical Name : CAS NO.: 23360-92-1Molecular formula : C46H56N4O9Molecular Weight: 809 g/molClassification : MedChemExpress Products > Natural Products > LeurosineDescription: Leurosine is an analog of…
Kaempferol-3-rutinoside
Product Name : Kaempferol-3-rutinosideSynonym : Chemical Name : CAS NO.: 17650-84-9Molecular formula : C27H30O15Molecular Weight: 594.52 g/molClassification : MedChemExpress Products > Natural Products > Flavonoids > Flavones and Isoflavones >…
2,3-Dihydrothieno-thiadiazole carboxylate
Product Name : 2,3-Dihydrothieno-thiadiazole carboxylateSynonym : Chemical Name : CAS NO.: 152467-47-5Molecular formula : C6H4N2O2S2Molecular Weight: 200.20 g/molClassification : MedChemExpress Products > Life Sciences > 2,3-Dihydrothieno-thiadiazole carboxylateDescription: 2,3-Dihydrothieno-thiadiazole carboxylate is…
Pdi inhibitor 16F16
Product Name : Pdi inhibitor 16F16Synonym : Chemical Name : CAS NO.: 922507-80-0Molecular formula : C16H17ClN2O3Molecular Weight: 320.77 g/molClassification : MedChemExpress Products > Research Chemicals > Pdi inhibitor 16F16Description: Pdi…
2-(7-Amino-4-methyl-2-oxo-2H-chromen-3-yl)acetic acid
Product Name : 2-(7-Amino-4-methyl-2-oxo-2H-chromen-3-yl)acetic acidSynonym : Chemical Name : CAS NO.: 106562-32-7Molecular formula : C12H11NO4Molecular Weight: 233.22 g/molClassification : MedChemExpress Products > Research Chemicals > 2-(7-Amino-4-methyl-2-oxo-2H-chromen-3-yl)acetic acidDescription: 2-(7-Amino-4-methyl-2-oxo-2H-chromen-3-yl)acetic acid is…
(10E)-10-Pentadecenoic acid
Product Name : (10E)-10-Pentadecenoic acidSynonym : Chemical Name : CAS NO.: 321744-58-5Molecular formula : C15H28O2Molecular Weight: 240.38 g/molClassification : MedChemExpress Products > Research Chemicals > (10E)-10-Pentadecenoic acidDescription: 10-Pentadecenoic acid is…
Temocaprilat
Product Name : TemocaprilatSynonym : (2S,6R)-6-amino]tetrahydro-5-oxo-2-(2-thienyl)-1,4- thiazepine-4(5H)-acetic acidChemical Name : CAS NO.: 110221-53-9Molecular formula : C21H24N2O5S2Molecular Weight: 448.56 g/molClassification : MedChemExpress Products > Research Chemicals > TemocaprilatDescription: Temocaprilat is a…
N-(4-Fluorophenyl)-4-phenyl-1,3-thiazol-2-amine
Product Name : N-(4-Fluorophenyl)-4-phenyl-1,3-thiazol-2-amineSynonym : Chemical Name : CAS NO.: 339303-87-6Molecular formula : C15H11FN2SMolecular Weight: 270.32 g/molClassification : MedChemExpress Products > Life Sciences > N-(4-Fluorophenyl)-4-phenyl-1,3-thiazol-2-amineDescription: N-(4-Fluorophenyl)-4-phenyl-1,3-thiazol-2-amine is a peptide that…
Ras/Rac Transformation Blocker, SCH 51344
Product Name : Ras/Rac Transformation Blocker, SCH 51344Synonym : Chemical Name : CAS NO.: 171927-40-5Molecular formula : C16H20N4O3Molecular Weight: 316.36 g/molClassification : MedChemExpress Products > Research Chemicals > Ras/Rac Transformation…
GSK PERK inhibitor
Product Name : GSK PERK inhibitorSynonym : 1-pyrimidin-5-yl)-2,3-dihydro-1H-indol-1-yl]-2-ethanoneChemical Name : CAS NO.: 1337531-89-1Molecular formula : C24H19F4N5OMolecular Weight: 469.43 g/molClassification : MedChemExpress Products > Life Sciences > GSK PERK inhibitorDescription: Inhibitor…
SG3199
Product Name : SG3199Synonym : Chemical Name : CAS NO.: 1595275-71-0Molecular formula : C33H36N4O6Molecular Weight: 584.7 g/molClassification : MedChemExpress Products > Life Sciences > Ligands > DNA Cross Linkers >…
Abz-Ala-Gly-Leu-Ala-p-Nitro-Benzyl-Amide
Product Name : Abz-Ala-Gly-Leu-Ala-p-Nitro-Benzyl-AmideSynonym : Chemical Name : CAS NO.: 100307-95-7Molecular formula : C28H37N7O7Molecular Weight: 583.64 g/molClassification : MedChemExpress Products > Life Sciences > Abz-Ala-Gly-Leu-Ala-p-Nitro-Benzyl-AmideDescription: Abz-Ala-Gly-Leu-Ala-p-Nitro-Benzyl-Amide is an enzyme inhibitor…
Fialuridine – Bio-X ™
Product Name : Fialuridine - Bio-X ™Synonym : 1-(2'-Deoxy-2'-fluoro-β-D-arabinofuranosyl)-5-iodouracilChemical Name : CAS NO.: 69123-98-4Molecular formula : C9H10FIN2O5Molecular Weight: 372.09 g/molClassification : MedChemExpress Products > Nucleosides > Nucleosides, Nucleotides and Nucleic…
Kaempferol-3-(p-coumaryl)glucoside
Product Name : Kaempferol-3-(p-coumaryl)glucosideSynonym : TilirosideChemical Name : CAS NO.: 20316-62-5Molecular formula : C30H26O13Molecular Weight: 594.52 g/molClassification : MedChemExpress Products > Natural Products > Flavonoids > Flavones and Isoflavones >…
3′-Deoxy-3′-fluoroxylocytidine
Product Name : 3'-Deoxy-3'-fluoroxylocytidineSynonym : 1-(3-Deoxy-3-fluoro-D-xylofuranosyl)cytosineChemical Name : CAS NO.: 26563-01-9Molecular formula : Molecular Weight: Classification : MedChemExpress Products > Nucleosides > 3'-Deoxy-3'-fluoroxylocytidineDescription: 3'-Deoxy-3'-fluoroxylocytidine is a synthetic phosphate derivative of…
meso-Tetrakis(2-pyridyl)porphine
Product Name : meso-Tetrakis(2-pyridyl)porphineSynonym : 5,10,15,20-Tetra-2-pyridinyl-21H,23H-porphine5,10,15,20-Tetra-2-pyridylporphine5,10,15,20-Tetrakis(2-pyridyl)porphyrinChemical Name : CAS NO.: 40904-90-3Molecular formula : C40H26N8Molecular Weight: 618.69 g/molClassification : MedChemExpress Products > Research Chemicals > meso-Tetrakis(2-pyridyl)porphineDescription: Tetrakis(2-pyridyl)porphine (Tpp) is a chemical…
Farnesene – mixed isomers
Product Name : Farnesene - mixed isomersSynonym : 3,7,11-Trimethyldodeca-1,3,6,10-tetraeneChemical Name : CAS NO.: 125037-13-0Molecular formula : C15H24Molecular Weight: 204.35 g/molClassification : MedChemExpress Products > Research Chemicals > Farnesene - mixed…
3-Acetyl-alpha-boswellic acid
Product Name : 3-Acetyl-alpha-boswellic acidSynonym : Chemical Name : CAS NO.: 89913-60-0Molecular formula : C32H50O4Molecular Weight: 498.74 g/molClassification : MedChemExpress Products > Research Chemicals >Fine Chemicals > 3-Acetyl-alpha-boswellic acidDescription: 3-Acetyl-alpha-boswellic…
Axatilimab
Product Name : AxatilimabSynonym : Chemical Name : CAS NO.: 2155851-88-8Molecular formula : Molecular Weight: Classification : MedChemExpress Products > Life Sciences > Antibodies > Monoclonal Antibodies > AxatilimabDescription: Humanized…
10-Hydroxycamptothecin
Product Name : 10-HydroxycamptothecinSynonym : Chemical Name : CAS NO.: 19685-09-7Molecular formula : C20H16N2O5Molecular Weight: 364.35 g/molClassification : MedChemExpress Products > Natural Products > 10-HydroxycamptothecinDescription: 10-Hydroxycamptothecin is a cytotoxic drug…
Erythromycylamine
Product Name : ErythromycylamineSynonym : (9S)-9-Amino-9-deoxoerythromycin(9S)-9-Deoxy-9-aminoerythromycin A(9S)-Erythromycylamine AChemical Name : CAS NO.: 26116-56-3Molecular formula : C37H70N2O12Molecular Weight: 734.96 g/molClassification : MedChemExpress Products > Antimicrobials > Antibiotics > ErythromycylamineDescription: Erythromycylamine is…
HOOCCH2O-PEG2-CH2COOtBu
Product Name : HOOCCH2O-PEG2-CH2COOtBuSynonym : Chemical Name : CAS NO.: 883564-93-0Molecular formula : C12H22O7Molecular Weight: 278.3 g/molClassification : MedChemExpress Products > Research Chemicals > HOOCCH2O-PEG2-CH2COOtBuDescription: HOOCCH2O-PEG2-CH2COOtBu is a PEG linker…
Propargyl-PEG4-thiol
Product Name : Propargyl-PEG4-thiolSynonym : Chemical Name : CAS NO.: 1347750-80-4Molecular formula : C11H20O4SMolecular Weight: 248.34 g/molClassification : MedChemExpress Products > PEG Polymers > Propargyl-PEG4-thiolDescription: Propargyl-PEG4-thiol is a versatile PEG…
Anisofolin A
Product Name : Anisofolin ASynonym : Chemical Name : CAS NO.: 83529-71-9Molecular formula : C39H32O14Molecular Weight: 724.7 g/molClassification : MedChemExpress Products > Natural Products > Anisofolin ADescription: Anisofolin A is…
Lithospermic acid
Product Name : Lithospermic acidSynonym : Chemical Name : CAS NO.: 28831-65-4Molecular formula : C27H22O12Molecular Weight: 538.46 g/molClassification : MedChemExpress Products > Research Chemicals > Lithospermic acidDescription: Lithospermic acid is…
Sugammadex
Product Name : SugammadexSynonym : Bridion6A,6B,6C,6D,6E,6F,6G,6H-Octakis-S-(2-carboxyethyl)-6A,6B,6C,6D,6E,6F,6G,6H-octathio-gamma-cyclodextrinChemical Name : CAS NO.: 343306-71-8Molecular formula : C72H112O48S8Molecular Weight: 2,002.16 g/molClassification : MedChemExpress Products > Carbohydrates > Oligosaccharides > SugammadexDescription: Steroid-based neuromuscular blocker reversing…
Myosmine
Product Name : MyosmineSynonym : 3-(1-Pyrrolin-2-yl)pyridineChemical Name : CAS NO.: 532-12-7Molecular formula : C9H10N2Molecular Weight: 146.19 g/molClassification : MedChemExpress Products > Natural Products > Alkaloids > MyosmineDescription: Myosmine is a…
Boc-trans-4-fluoro-L-proline
Product Name : Boc-trans-4-fluoro-L-prolineSynonym : (2S,4R)-4-Fluoropyrrolidine-1,2-dicarboxylic acid 1-tert-butyl esterChemical Name : CAS NO.: 203866-14-2Molecular formula : C10H16FNO4Molecular Weight: 233.24 g/molClassification : MedChemExpress Products > Research Chemicals > Boc-trans-4-fluoro-L-prolineDescription: Boc-trans-4-fluoro-L-proline is…
Lauramidopropyl betaine – 35% in water
Product Name : Lauramidopropyl betaine - 35% in waterSynonym : Cocamidopropyl BetaineChemical Name : CAS NO.: 4292-10-8Molecular formula : C19H38N2O3Molecular Weight: 342.52 g/molClassification : MedChemExpress Products > Research Chemicals >…
Sodiumallopurinol
Product Name : SodiumallopurinolSynonym : Chemical Name : CAS NO.: 17795-21-0Molecular formula : C5H3N4NaOMolecular Weight: 158.09 g/molClassification : MedChemExpress Products > Research Chemicals > SodiumallopurinolDescription: Sodium allopurinol is a drug…
Verapamil HCl – Bio-X ™
Product Name : Verapamil HCl - Bio-X ™Synonym : Chemical Name : CAS NO.: 152-11-4Molecular formula : C27H38N2O4•HClMolecular Weight: 491.06 g/molClassification : MedChemExpress Products > Life Sciences > Ligands >…
Bispyribac sodium
Product Name : Bispyribac sodiumSynonym : Sodium2,6-bisbenzoate2,6-Bis((4,6-dimethoxy-2-pyrimidinyl)oxy)-benzoic acid sodiumChemical Name : CAS NO.: 125401-92-5Molecular formula : C19H17N4NaO8Molecular Weight: 452.35 g/molClassification : MedChemExpress Products > Research Chemicals > Bispyribac sodiumDescription: Bispyribac…
N-Decanoyl-DL-homoserine lactone
Product Name : N-Decanoyl-DL-homoserine lactoneSynonym : Chemical Name : CAS NO.: 106983-36-2Molecular formula : C14H25NO3Molecular Weight: 255.35 g/molClassification : MedChemExpress Products > Research Chemicals > N-Decanoyl-DL-homoserine lactoneDescription: N-Decanoyl-DL-homoserine lactone is…
Sophorabioside
Product Name : SophorabiosideSynonym : Chemical Name : CAS NO.: 2945-88-2Molecular formula : C27H30O14Molecular Weight: 578.52 g/molClassification : MedChemExpress Products > Natural Products > SophorabiosideDescription: Sophorabioside is a flavonol glycoside…
4-Methylumbelliferyl a-L-arabinofuranoside
Product Name : 4-Methylumbelliferyl a-L-arabinofuranosideSynonym : Chemical Name : CAS NO.: 77471-44-4Molecular formula : C15H16O7Molecular Weight: 308.28 g/molClassification : MedChemExpress Products > Enzyme Substrates > Fluorogenic Substrates > MU Substrates…
TAS-103 dihydrochloride
Product Name : TAS-103 dihydrochlorideSynonym : Chemical Name : CAS NO.: 174634-09-4Molecular formula : C20H21Cl2N3O2Molecular Weight: 406.31 g/molClassification : MedChemExpress Products > Research Chemicals > TAS-103 dihydrochlorideDescription: TAS-103 dihydrochloride is…
L-Arginine a-ketoglutarate (1:1)
Product Name : L-Arginine a-ketoglutarate (1:1)Synonym : AAKGChemical Name : CAS NO.: 16856-18-1Molecular formula : C6H14N4O2·C5H6O5Molecular Weight: 320.3 g/molClassification : MedChemExpress Products > Research Chemicals >Fine Chemicals > L-Arginine a-ketoglutarate…
Glucagon (Human)
Product Name : Glucagon (Human)Synonym : His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-ThrChemical Name : CAS NO.: 16941-32-5Molecular formula : C153H225N43O49SMolecular Weight: 3,482.7 g/molClassification : MedChemExpress Products > Life Sciences > Glucagon (Human)Description: Glucagon is a…
Flunixin meglumine
Product Name : Flunixin meglumineSynonym : 2-amino]-3-pyridinecarboxylic acid 1-deoxy-1-(methylamino)-D-glucitol2-(2-Methyl-3-trifluorome thylanilino)nicotinic acid N-methyl-D-glucamine saltBanamineChemical Name : CAS NO.: 42461-84-7Molecular formula : C21H28F3N3O7Molecular Weight: 491.46 g/molClassification : MedChemExpress Products > Research Chemicals…
Oxotremorine M
Product Name : Oxotremorine MSynonym : Chemical Name : CAS NO.: 3854-04-4Molecular formula : C11H19IN2OMolecular Weight: 322.19 g/molClassification : MedChemExpress Products > Research Chemicals > Oxotremorine MDescription: Oxotremorine M is…
[Arg8]-Vasopressin
Product Name : -VasopressinSynonym : H--Pro-Arg-Gly-NH2 VP antidiuretic hormone argipressin vasopressin-neurophysin 2-copeptin ADH Vasopressin AVPChemical Name : CAS NO.: 113-79-1Molecular formula : C46H65N15O12S2Molecular Weight: 1,084.25 g/molClassification : MedChemExpress Products >…
Amino-PEG9-t-butyl ester
Product Name : Amino-PEG9-t-butyl esterSynonym : Chemical Name : CAS NO.: 1818294-44-8Molecular formula : C25H51NO11Molecular Weight: 541.7 g/molClassification : MedChemExpress Products > Research Chemicals > Amino-PEG9-t-butyl esterDescription: Amino-PEG9-t-butyl ester is…
Vilazodone
Product Name : VilazodoneDescription:Vilazodone is a serotonergic antidepressant. Vilazodone was approved by the FDA for use in the United States to treat major depressive disorder in 2011. The mechanism of…
Ostarine
Product Name : OstarineDescription:Ostarine, aslo known as Enobosarm, and MK-2866 and GTX-024, is selective androgen receptor modulator with anabolic activity. Selective androgen receptor modulator (SARM) GTx-024 is designed to work…
2-Chloro-L-phenylalanine
Product Name : 2-Chloro-L-phenylalanineSynonym : L-Phe(2-Cl)-OHo-Chloro-L-phenylalanine(S)-2-Amino-3-(2-chlorophenyl)propionic acidChemical Name : CAS NO.: 103616-89-3Molecular formula : C9H10ClNO2Molecular Weight: 199.63 g/molClassification : MedChemExpress Products > Research Chemicals > 2-Chloro-L-phenylalanineDescription: 2-Chloro-L-phenylalanine (2CLP) is a…
L-Proline-beta-naphthylamide hydrochloride
Product Name : L-Proline-beta-naphthylamide hydrochlorideSynonym : L-Pro-bNA·HCl(S)-Pyrrolidine-2-carboxylic acid-b-naphthylamide hydrochlorideChemical Name : CAS NO.: 97216-16-5Molecular formula : C15H16N2O·HClMolecular Weight: 276.76 g/molClassification : MedChemExpress Products > Research Chemicals > L-Proline-beta-naphthylamide hydrochlorideDescription: L-proline…
Boc-L-tyrosine methyl ester
Product Name : Boc-L-tyrosine methyl esterSynonym : Chemical Name : CAS NO.: 4326-36-7Molecular formula : C15H21NO5Molecular Weight: 295.33 g/molClassification : MedChemExpress Products > Research Chemicals > Boc-L-tyrosine methyl esterDescription: Boc-L-tyrosine…
Amyloid β-Peptide (1-37) (human)
Product Name : Amyloid β-Peptide (1-37) (human)Description:Amyloid β-Peptide (1-37) (human) is an amyloid β-protein fragment cleaved from amyloid precursor protein (APP).CAS: 186359-67-1Molecular Weight:4074.49Formula: C182H274N50O55SChemical Name: Amyloid beta-Peptide (1-37) (human)Smiles :…
8-Bromo-AMP
Product Name : 8-Bromo-AMPSynonym : Chemical Name : CAS NO.: 23567-96-6Molecular formula : C10H13BrN5O7PMolecular Weight: 426.12 g/molClassification : MedChemExpress Products > Research Chemicals > 8-Bromo-AMPDescription: 8-Bromo-AMP is a nucleotide analog…
Triptoquinone B
Product Name : Triptoquinone BSynonym : Chemical Name : CAS NO.: 142937-50-6Molecular formula : C20H26O4Molecular Weight: 330.4 g/molClassification : MedChemExpress Products > Controlled Products > Triptoquinone BDescription: Triptoquinone B is…
Caulophylline B
Product Name : Caulophylline BSynonym : Chemical Name : CAS NO.: 1359978-55-4Molecular formula : C19H21NO5Molecular Weight: 343.4 g/molClassification : MedChemExpress Products > Natural Products > Caulophylline BDescription: Caulophylline B is…
Carboxyamidotriazole
Product Name : CarboxyamidotriazoleDescription:Carboxyamidotriazole (L-651582) is a cytostatic inhibitor of nonvoltage-operated calcium channels and calcium channel-mediated signaling pathways. Carboxyamidotriazole shows anti-tumor, anti-inflammatory and antiangiogenic effects.CAS: 99519-84-3Molecular Weight:424.67Formula: C17H12Cl3N5O2Chemical Name: 5-amino-1-{methyl}-1H-1,2,3-triazole-4-carboxamideSmiles…
Sophoranone
Product Name : SophoranoneSynonym : Chemical Name : CAS NO.: 23057-55-8Molecular formula : C30H36O4Molecular Weight: 460.6 g/molClassification : MedChemExpress Products > Natural Products > SophoranoneDescription: Sophoranone is a pharmaceutical drug…
2′,3′-Dideoxyguanosine-5′-O-(1-thiotriphosphate)
Product Name : 2',3'-Dideoxyguanosine-5'-O-(1-thiotriphosphate)Synonym : Chemical Name : CAS NO.: 371195-56-1Molecular formula : C10H16N5O11P3SMolecular Weight: 507.25 g/molClassification : MedChemExpress Products > Nucleosides > 2',3'-Dideoxyguanosine-5'-O-(1-thiotriphosphate)Description: 2',3'-Dideoxyguanosine-5'-O-(1-thiotriphosphate) (2,3'-ddGTP) is a nucleoside that…
PF 184
Product Name : PF 184Synonym : Chemical Name : CAS NO.: 1187460-81-6Molecular formula : C32H32ClFN6O4Molecular Weight: 619.1 g/molClassification : MedChemExpress Products > Life Sciences > PF 184Description: PF 184 is…
BMS 433796
Product Name : BMS 433796Description:BMS 433796 is a γ-secretase inhibitor with Aβ lowering activity in a transgenic mouse model of Alzheimer's disease.CAS: 935525-13-6Molecular Weight:402.35Formula: C19H16F2N4O4Chemical Name: 1--3-ureaSmiles : CN1N=CC2C=CC=CC=2(NC(=O)NC(=O)(O)C2C=C(F)C=C(F)C=2)C1=OInChiKey: RDSOIKZEEGAJGL-HOTGVXAUSA-NInChi…
Lincomycin
Product Name : LincomycinSynonym : Methyl 6,8-dideoxy-6-carbonyl]amino]-1-thio-D-erythro-alpha-D-gluco-octopyranosideChemical Name : CAS NO.: 154-21-2Molecular formula : C18H34N2O6SMolecular Weight: 406.54 g/molClassification : MedChemExpress Products > Antimicrobials > Antibiotics > LincomycinDescription: Inhibitor of protein…
8-Hydroxy-3,5,6,7,3′,4′-hexamethoxyflavone
Product Name : 8-Hydroxy-3,5,6,7,3',4'-hexamethoxyflavoneSynonym : Chemical Name : CAS NO.: 1000415-56-4Molecular formula : C21H22O9Molecular Weight: 418.4 g/molClassification : MedChemExpress Products > Antimicrobials > 8-Hydroxy-3,5,6,7,3',4'-hexamethoxyflavoneDescription: 8-Hydroxy-3,5,6,7,3',4'-hexamethoxyflavone is a synthetic flavone that…
FIM-1
Product Name : FIM-1Synonym : Chemical Name : CAS NO.: 220518-50-3Molecular formula : C45H32N4O8Molecular Weight: 756.8 g/molClassification : MedChemExpress Products > Research Chemicals > FIM-1Description: FIM-1 is a lipid that…
(E/Z)-4-Hydroxytamoxifen
Product Name : (E/Z)-4-HydroxytamoxifenDescription:(E/Z)-4-Hydroxytamoxifen is a racemic compound of (Z)-4-Hydroxytamoxifen and (E)-4-Hydroxytamoxifen isomers. (E/Z)-4-Hydroxytamoxifen is an estrogen receptor modulator.CAS: 68392-35-8Molecular Weight:387.51Formula: C26H29NO2Chemical Name: 4-phenyl}-2-phenylbut-1-en-1-yl]phenolSmiles : CCC(=C(C1C=CC(O)=CC=1)C1C=CC(=CC=1)OCCN(C)C)C1C=CC=CC=1InChiKey: TXUZVZSFRXZGTL-OCEACIFDSA-NInChi : InChI=1S/C26H29NO2/c1-4-25(20-8-6-5-7-9-20)26(21-10-14-23(28)15-11-21)22-12-16-24(17-13-22)29-19-18-27(2)3/h5-17,28H,4,18-19H2,1-3H3/b26-25+Purity: ≥98%…
PSMα3
Product Name : PSMα3Description:PSMα3 is a peptide for manipulating DCs to become tolerogenic for DC vaccination strategies. PSMα3 penetrates and modulates human monocyte-derived DCs by altering the TLR2- or TLR4-induced…
Pinocembrin 7-o-[3”-o-galloyl-4”,6”-hexahydroxydiphenoyl]-β-D-glucoside
Product Name : Pinocembrin 7-o--β-D-glucosideSynonym : Chemical Name : CAS NO.: 205370-59-8Molecular formula : C42H32O21Molecular Weight: 872.7 g/molClassification : MedChemExpress Products > Controlled Products > Pinocembrin 7-o--β-D-glucosideDescription: Pinocembrin is a…
Sodium ricinolate
Product Name : Sodium ricinolateSynonym : Chemical Name : CAS NO.: 5323-95-5Molecular formula : C18H33NaO3Molecular Weight: 320.45 g/molClassification : MedChemExpress Products > Research Chemicals > Sodium ricinolateDescription: Sodium ricinolate is…
CER11-2′R(d9)
Product Name : CER11-2′R(d9)Synonym : Chemical Name : CAS NO.: 2260670-23-1Molecular formula : C34H60D9NO4Molecular Weight: 564.97 g/molClassification : MedChemExpress Products > Life Sciences > CER11-2′R(d9)Description: CER11-2′R(d9) is a research tool…
m-PEG7-Ms
Product Name : m-PEG7-MsDescription:m-PEG7-Ms is a PEG-based PROTAC linker can be used in the synthesis of PROTACs. m-PEG7-Ms is a cleavable ADC linker used in the synthesis of antibody-drug conjugates…
ML327
Product Name : ML327Synonym : Chemical Name : CAS NO.: 1883510-31-3Molecular formula : C19H18N4O4Molecular Weight: 366.37 g/molClassification : MedChemExpress Products > Life Sciences > ML327Description: ML327 is a small molecule…
H-Trp-Asn-OH
Product Name : H-Trp-Asn-OHSynonym : Chemical Name : CAS NO.: 175027-11-9Molecular formula : C15H18N4O4Molecular Weight: 318.33 g/molClassification : MedChemExpress Products > Research Chemicals > H-Trp-Asn-OHDescription: H-Trp-Asn-OH is a synthetic amino…
mPEG12-Br
Product Name : mPEG12-BrSynonym : Chemical Name : CAS NO.: 1620461-89-3Molecular formula : C25H51BrO12Molecular Weight: 623.6 g/molClassification : MedChemExpress Products > PEG Polymers > mPEG12-BrDescription: mPEG12-Br, also known as PEG…
p-Coumaric Acid
Product Name : p-Coumaric AcidDescription:p-Coumaric acid (4-Hydroxycinnamic acid, P-Hydroxycinnamic acid, 4-Coumaric acid, Trans-p-Coumaric acid, para-Coumaric Acid) is a hydroxy derivative of cinnamic acid found in a variety of edible plants…
Rimonabant Hydrochloride
Product Name : Rimonabant HydrochlorideDescription:Rimonabant, also known as SR141716 and A 281, is an anorectic anti-obesity drug. It is an inverse agonist for the cannabinoid receptor CB1. Its main avenue…
Fmoc-N-Amido-dPEG®8-Acid
Product Name : Fmoc-N-Amido-dPEG®8-AcidSynonym : Chemical Name : CAS NO.: 756526-02-0Molecular formula : C34H49NO12Molecular Weight: 663.75 g/molClassification : MedChemExpress Products > Life Sciences > Fmoc-N-Amido-dPEG®8-AcidDescription: Fmoc-N-Amino Acid is a building…
S-Adenosyl-L-methionine
Product Name : S-Adenosyl-L-methionineSynonym : SAMe, Ado-Met, Ademetionine, (3S)-5'--5'-deoxyadenosineChemical Name : CAS NO.: 29908-03-0Molecular formula : C15H22N6O5SMolecular Weight: 398.44 g/molClassification : MedChemExpress Products > Nucleosides > Nucleosides, Nucleotides and Nucleic…
(R)-N-(Prop-2-yn-1-yl)-2,3-dihydro-1H-inden-1-amine
Product Name : (R)-N-(Prop-2-yn-1-yl)-2,3-dihydro-1H-inden-1-amineSynonym : RasagilineChemical Name : CAS NO.: 136236-51-6Molecular formula : C12H13NMolecular Weight: 171.24 g/molClassification : MedChemExpress Products > Research Chemicals > (R)-N-(Prop-2-yn-1-yl)-2,3-dihydro-1H-inden-1-amineDescription: (R)-N-(Prop-2-yn-1-yl)-2,3-dihydro-1H-inden-1-amine is a type of…
RR-11a analog
Product Name : RR-11a analogDescription:RR-11a analog is a potent and selective inhibitors of asparaginyl endopeptidases (AE) (Legumain), with IC50 values of 4.5 nM, 4.5 nM and 31 nM for AE1…
Inolitazone
Product Name : InolitazoneDescription:Efatutazone Free Base is a high-affinity PPARgamma agonist with antineoplastic activity.CAS: 223132-37-4Molecular Weight:502.58Formula: C27H26N4O4SChemical Name: 5-methoxy}phenyl)methyl]-1,3-thiazolidine-2,4-dioneSmiles : CN1C2=CC(=CC=C2N=C1COC1C=CC(CC2SC(=O)NC2=O)=CC=1)OC1C=C(C)C(N)=C(C)C=1InChiKey: JCYNMRJCUYVDBC-UHFFFAOYSA-NInChi : InChI=1S/C27H26N4O4S/c1-15-10-20(11-16(2)25(15)28)35-19-8-9-21-22(13-19)31(3)24(29-21)14-34-18-6-4-17(5-7-18)12-23-26(32)30-27(33)36-23/h4-11,13,23H,12,14,28H2,1-3H3,(H,30,32,33)Purity: ≥98% (or refer to the Certificate…
Enclomiphene citrate – Bio-X ™
Product Name : Enclomiphene citrate - Bio-X ™Synonym : Chemical Name : CAS NO.: 7599-79-3Molecular formula : C26H28ClNO•C6H8O7Molecular Weight: 598.08 g/molClassification : MedChemExpress Products > Life Sciences > Enclomiphene citrate…
AQX 1125 acetate
Product Name : AQX 1125 acetateSynonym : Chemical Name : CAS NO.: 782487-29-0Molecular formula : Molecular Weight: Classification : MedChemExpress Products > Life Sciences > AQX 1125 acetateDescription: AQX 1125…
BAY-1436032
Product Name : BAY-1436032Synonym : Chemical Name : CAS NO.: 1803274-65-8Molecular formula : C26H30F3N3O3Molecular Weight: 489.53 g/molClassification : MedChemExpress Products > Life Sciences > BAY-1436032Description: BAY-1436032 is a novel small…
PROTAC ERα Y537S degrader-1
Product Name : PROTAC ERα Y537S degrader-1Description:PROTAC ERa Y537S dearader-1 comprises a ubiauitin E3 liaase binding aroup a linker and a protein binding aroup PROTAC ERa Y537S degrader-1 extracts from…
Ac-Leu-Glu-His-Asp-chloromethylketone
Product Name : Ac-Leu-Glu-His-Asp-chloromethylketoneSynonym : Chemical Name : CAS NO.: 403848-57-7Molecular formula : C24H35ClN6O9Molecular Weight: 587.02 g/molClassification : MedChemExpress Products > Research Chemicals > Ac-Leu-Glu-His-Asp-chloromethylketoneDescription: Ac-Leu-Glu-His-Asp-chloromethylketone is a creatine kinase…
C.I.Azoic Coupling Component 10
Product Name : C.I.Azoic Coupling Component 10Synonym : Chemical Name : CAS NO.: 92-78-4Molecular formula : C17H12ClNO2Molecular Weight: 297.74 g/molClassification : MedChemExpress Products > Research Chemicals >Fine Chemicals > C.I.Azoic…
TPO agonist 1
Product Name : TPO agonist 1Synonym : Chemical Name : CAS NO.: 1033040-23-1Molecular formula : C25H22N8O2Molecular Weight: 466.49 g/molClassification : MedChemExpress Products > Life Sciences > TPO agonist 1Description: TPO…
BMS-986318
Product Name : BMS-986318Description:BMS-986318 is a potent nonbile acid FXR agonist with EC50s of 53 and 350 nM in the FXR Gal4 and SRC-1 recruitment assays, respectively. BMS-986318 has a…
CGS 9343B
Product Name : CGS 9343BSynonym : Chemical Name : CAS NO.: 109826-27-9Molecular formula : C26H28N4O2·C4H4O4Molecular Weight: 544.61 g/molClassification : MedChemExpress Products > Life Sciences > CGS 9343BDescription: CGS 9343B is…
MK-5204
Product Name : MK-5204Synonym : Chemical Name : CAS NO.: 1207751-75-4Molecular formula : Molecular Weight: Classification : MedChemExpress Products > Life Sciences > MK-5204Description: MK-5204 is a novel antifungal agent…
6′-Methoxy-2′-acetonaphthone
Product Name : 6'-Methoxy-2'-acetonaphthoneSynonym : 1-(6-Methoxy-2-naphthalenyl)ethanoneNaproxen impurity LChemical Name : CAS NO.: 3900-45-6Molecular formula : C13H12O2Molecular Weight: 200.23 g/molClassification : MedChemExpress Products > Impurities > iNaproxen > 6'-Methoxy-2'-acetonaphthoneDescription: 6'-Methoxy-2'-acetonaphthone is…
Decamethoxine
Product Name : DecamethoxineDescription:Product informationCAS: 38146-42-8Molecular Weight:693.91Formula: C38H74Cl2N2O4Chemical Name: 1, 10-Decanediaminium, N, N, N', N'-tetramethyl-N, N'-bisoxy]-2-oxoethyl]-, dichlorideSmiles : ..C(C)(CC(=O)OC1CC(C)CCC1C(C)C)CCCCCCCCCC(C)(C)CC(=O)OC1CC(C)CCC1C(C)CInChiKey: LRQIWRXCHWNNEA-UHFFFAOYSA-LInChi : InChI=1S/C38H74N2O4.2ClH/c1-29(2)33-21-19-31(5)25-35(33)43-37(41)27-39(7,8)23-17-15-13-11-12-14-16-18-24-40(9,10)28-38(42)44-36-26-32(6)20-22-34(36)30(3)4;;/h29-36H,11-28H2,1-10H3;2*1H/q+2;;/p-2Purity: ≥98% (or refer to the Certificate of Analysis)Shipping…
Lipid peroxidation inhibitor 1
Product Name : Lipid peroxidation inhibitor 1Description:Lipid peroxidation inhibitor 1 is a lipid peroxidation inhibitor with an IC50 of 0.07 μM.CAS: 142873-41-4Molecular Weight:364.52Formula: C24H32N2OChemical Name: 2,4,6,7-tetramethyl-2--2,3-dihydro-1-benzofuran-5-amineSmiles : CC1=C2OC(C)(CC2=C(C)C(N)=C1C)CN1CCC(CC1)C1C=CC=CC=1InChiKey: OFJJFTDZPRQPBY-UHFFFAOYSA-NInChi :…
Aminooxy-PEG5-azide
Product Name : Aminooxy-PEG5-azideSynonym : Chemical Name : CAS NO.: 1919045-02-5Molecular formula : C12H26N4O6Molecular Weight: 322.36 g/molClassification : MedChemExpress Products > Research Chemicals > Aminooxy-PEG5-azideDescription: Aminooxy-PEG5-azide is a versatile PEG…
Amino-dPEG®6-t-Butyl Ester
Product Name : Amino-dPEG®6-t-Butyl EsterSynonym : Chemical Name : CAS NO.: 1286281-32-0Molecular formula : C19H39NO8Molecular Weight: 409.51 g/molClassification : MedChemExpress Products > Life Sciences > Amino-dPEG®6-t-Butyl EsterDescription: Amino-dPEG6-t-Butyl Ester is…
Bremelanotide
Product Name : BremelanotideSynonym : N-Acetyl-L-norleucyl-L-alpha-aspartyl-L-histidyl-D-phenylalanyl-L-arginyl-L-tryptophyl-L-lysine (2-7)-lactamPT141Chemical Name : CAS NO.: 189691-06-3Molecular formula : C50H68N14O10Molecular Weight: 1,025.16 g/molClassification : MedChemExpress Products > Life Sciences > BremelanotideDescription: Bremelanotide is a synthetic…
Complement factor D-IN-1
Product Name : Complement factor D-IN-1Description:Complement factor D-IN-1 is a potent and selective small-molecule reversible factor d inhibitor, with IC50s of 0.006 and 0.05 μM in FD Thioesterolytic Fluorescent Assay…
Phosphoramidon disodium salt
Product Name : Phosphoramidon disodium saltSynonym : Chemical Name : CAS NO.: 164204-38-0Molecular formula : C23H32N3Na2O10PMolecular Weight: 587.47 g/molClassification : MedChemExpress Products > Research Chemicals > Phosphoramidon disodium saltDescription: Phosphoramidon…
VA-K-14 hydrochloride
Product Name : VA-K-14 hydrochlorideSynonym : Chemical Name : CAS NO.: 1171341-19-7Molecular formula : C18H16ClN3SMolecular Weight: 341.9 g/molClassification : MedChemExpress Products > Life Sciences > VA-K-14 hydrochlorideDescription: VA-K-14 is a…
Scutellarein 7-methyl ether
Product Name : Scutellarein 7-methyl etherSynonym : SorbifolinChemical Name : CAS NO.: 23130-22-5Molecular formula : C16H12O6Molecular Weight: 300.26 g/molClassification : MedChemExpress Products > Natural Products > Flavonoids > Flavones and…
TAS-119
Product Name : TAS-119Description:TAS-119 is a potent, selective and orally active Aurora A inhibitor with an IC50 of 1.0 nM. TAS-119 shows high selectivity for Aurora A over other protein…
BMS-986202
Product Name : BMS-986202Description:BMS-986202 is a potent, selective and orally active Tyk2 inhibitor that binds to Tyk2 JH2 with an IC50 of 0.19 nM and a Ki of 0.02 nM.…
M4284
Product Name : M4284Synonym : Chemical Name : CAS NO.: 1373346-85-0Molecular formula : C23H28N2O8Molecular Weight: 460.5 g/molClassification : MedChemExpress Products > Antimicrobials > M4284Description: M4284 is a broad-spectrum antibiotic that…
DAPTA
Product Name : DAPTASynonym : Chemical Name : CAS NO.: 106362-34-9Molecular formula : C35H56N10O15Molecular Weight: 856.88 g/molClassification : MedChemExpress Products > Life Sciences > DAPTADescription: Dapta is a basic protein…
Retrorsine N-oxide
Product Name : Retrorsine N-oxideSynonym : Chemical Name : CAS NO.: 15503-86-3Molecular formula : C18H25NO7Molecular Weight: 367.39 g/molClassification : MedChemExpress Products > Natural Products > Retrorsine N-oxideDescription: Retrorsine N-oxide is…
Mal-NH-PEG8-CH2CH2COOPFP ester
Product Name : Mal-NH-PEG8-CH2CH2COOPFP esterDescription:Mal-NH-PEG8-CH2CH2COOPFP ester is a PEG-based PROTAC linker that can be used in the synthesis of PROTACs.CAS: 2055023-14-6Molecular Weight:758.68Formula: C32H43F5N2O13Chemical Name: 2,3,4,5,6-pentafluorophenyl 1--3,6,9,12,15,18,21,24-octaoxaheptacosan-27-oateSmiles : O=C(CCOCCOCCOCCOCCOCCOCCOCCOCCNC(=O)CCN1C(=O)C=CC1=O)OC1C(F)=C(F)C(F)=C(F)C=1FInChiKey: FEGJRGANWNMURJ-UHFFFAOYSA-NInChi :…
Capsaicin – Natural
Product Name : Capsaicin - NaturalSynonym : (6E)-N--8-methyl-6-nonenamide(E)-8-Methyl-N-vanillyl-6-nonenamideChemical Name : CAS NO.: 404-86-4Molecular formula : C18H27NO3Molecular Weight: 305.41 g/molClassification : MedChemExpress Products > Natural Products > Capsaicin - NaturalDescription: Capsaicin…
GB 83
Product Name : GB 83Synonym : Chemical Name : CAS NO.: 1252806-86-2Molecular formula : C32H44N4O4Molecular Weight: 548.7 g/molClassification : MedChemExpress Products > Life Sciences > GB 83Description: GB 83 is…
Domperidone, pharma grade
Product Name : Domperidone, pharma gradeSynonym : Chemical Name : CAS NO.: 57808-66-9Molecular formula : C22H24ClN5O2Molecular Weight: 425.91 g/molClassification : MedChemExpress Products > Life Sciences > Ligands > Dopamine Receptors…
Bromo-PEG5-phosphonic acid
Product Name : Bromo-PEG5-phosphonic acidDescription:Bromo-PEG5-phosphonic acid is a PEG-based PROTAC linker that can be used in the synthesis of PROTACs.CAS: 1446282-37-6Molecular Weight:409.21Formula: C12H26BrO8PChemical Name: (17-bromo-3,6,9,12,15-pentaoxaheptadecan-1-yl)phosphonic acidSmiles : OP(O)(=O)CCOCCOCCOCCOCCOCCBrInChiKey: ASIUTFVREYVRJH-UHFFFAOYSA-NInChi :…
Givinostat hydrochloride
Product Name : Givinostat hydrochlorideSynonym : Chemical Name : CAS NO.: 199657-29-9Molecular formula : C24H27N3O4·HClMolecular Weight: 457.95 g/molClassification : MedChemExpress Products > Research Chemicals > Givinostat hydrochlorideDescription: Givinostat hydrochloride is…
Hardwickic acid
Product Name : Hardwickic acidSynonym : Chemical Name : CAS NO.: 1782-65-6Molecular formula : C20H28O3Molecular Weight: 316.4 g/molClassification : MedChemExpress Products > Natural Products > Hardwickic acidDescription: Hardwickic acid is…
Alloisoimperatorin
Product Name : AlloisoimperatorinSynonym : Chemical Name : CAS NO.: 35214-83-6Molecular formula : C16H14O4Molecular Weight: 270.28 g/molClassification : MedChemExpress Products > Natural Products > Coumarins > AlloisoimperatorinDescription: Alloisoimperatorin is a…
Cbz-NH-PEG3-C2-acid
Product Name : Cbz-NH-PEG3-C2-acidDescription:Cbz-NH-PEG3-C2-acid is a PEG-based PROTAC linker that can be used in the synthesis of PROTACs.CAS: 1310327-18-4Molecular Weight:355.38Formula: C17H25NO7Chemical Name: 3-{2-amino}ethoxy)ethoxy]ethoxy}propanoic acidSmiles : OC(=O)CCOCCOCCOCCNC(=O)OCC1C=CC=CC=1InChiKey: SBHUTZVKPJPFBD-UHFFFAOYSA-NInChi : InChI=1S/C17H25NO7/c19-16(20)6-8-22-10-12-24-13-11-23-9-7-18-17(21)25-14-15-4-2-1-3-5-15/h1-5H,6-14H2,(H,18,21)(H,19,20)Purity: ≥98%…
Aminooxy-PEG7-methane
Product Name : Aminooxy-PEG7-methaneDescription:Aminooxy-PEG7-methane is a PEG-based PROTAC linker that can be used in the synthesis of PROTACs.CAS: 1370698-27-3Molecular Weight:355.42Formula: C15H33NO8Chemical Name: O-(2,5,8,11,14,17,20-heptaoxadocosan-22-yl)hydroxylamineSmiles : COCCOCCOCCOCCOCCOCCOCCONInChiKey: DGGSCAFEGLNJGW-UHFFFAOYSA-NInChi : InChI=1S/C15H33NO8/c1-17-2-3-18-4-5-19-6-7-20-8-9-21-10-11-22-12-13-23-14-15-24-16/h2-16H2,1H3Purity: ≥98% (or…
AZD8848
Product Name : AZD8848Synonym : Chemical Name : CAS NO.: 866269-28-5Molecular formula : C29H43N7O5Molecular Weight: 569.7 g/molClassification : MedChemExpress Products > Impurities > AZD8848Description: AZD8848 is a potent inhibitor of…
3-Hydroxy-2-phenyl-N-[(1R)-1-phenylpropyl]quinoline-4-carboxamide hydrochloride
Product Name : 3-Hydroxy-2-phenyl-N-quinoline-4-carboxamide hydrochlorideSynonym : Chemical Name : CAS NO.: 204519-66-4Molecular formula : C25H23ClN2O2Molecular Weight: 418.9 g/molClassification : MedChemExpress Products > Life Sciences > 3-Hydroxy-2-phenyl-N-quinoline-4-carboxamide hydrochlorideDescription: 3-Hydroxy-2-phenyl-N-quinoline-4-carboxamide hydrochloride is…
Isorhynchophylline
Product Name : IsorhynchophyllineSynonym : Chemical Name : CAS NO.: 6859-01-4Molecular formula : Molecular Weight: Classification : MedChemExpress Products > Research Chemicals > IsorhynchophyllineDescription: Isorhynchophylline is a natural product that…
Hydroxy-PEG4-acid
Product Name : Hydroxy-PEG4-acidDescription:Hydroxy-PEG4-acid is a non-cleavable 4 unit PEG ADC linker used in the synthesis of antibody-drug conjugates (ADCs). Hydroxy-PEG4-acid is also a PEG-based PROTAC linker that can be…
Teprotumumab
Product Name : TeprotumumabSynonym : Chemical Name : CAS NO.: 1036734-93-6Molecular formula : Molecular Weight: Classification : MedChemExpress Products > Life Sciences > Antibodies > Monoclonal Antibodies > TeprotumumabDescription: Anti-Human…
Nemorubicin
Product Name : NemorubicinSynonym : PNU 152243Chemical Name : CAS NO.: 108852-90-0Molecular formula : C32H37NO13Molecular Weight: 643.64 g/molClassification : MedChemExpress Products > Life Sciences > Ligands > NemorubicinDescription: Nemorubicin is…
7,8,9,10-Tetrahydrobenzo[a]pyren-7-ol
Product Name : 7,8,9,10-Tetrahydrobenzopyren-7-olSynonym : Chemical Name : CAS NO.: 6272-55-5Molecular formula : C20H16OMolecular Weight: 272.34 g/molClassification : MedChemExpress Products > Research Chemicals > 7,8,9,10-Tetrahydrobenzopyren-7-olDescription: Tetrahydrobenzopyren-7-ol is a dibenzoate metabolite…
Tolnaftate (D7)
Product Name : Tolnaftate (D7)Description:Tolnaftate D7 (NP-27 D7) is the deuterium labeled Tolnaftate. Tolnaftate (NP-27) is a synthetic thiocarbamate used as an anti-fungal agent.CAS: 1329835-64-4Molecular Weight:314.45Formula: C19H17NOSChemical Name: N-methyl-N-(3-methylphenyl)-1-methanethioamideSmiles :…
TCO-PEG4-TCO
Product Name : TCO-PEG4-TCOSynonym : Chemical Name : CAS NO.: 2243569-23-3Molecular formula : C28H48N2O8Molecular Weight: 540.7 g/molClassification : MedChemExpress Products > Research Chemicals > TCO-PEG4-TCODescription: TCO-PEG4-TCO is a homobifunctional PEG…
Epiblastin A
Product Name : Epiblastin ASynonym : AUE6-(3-Chloro-phenyl)-pteridine-2,4,7-triamineChemical Name : CAS NO.: 16470-02-3Molecular formula : C12H10ClN7Molecular Weight: 287.71 g/molClassification : MedChemExpress Products > Life Sciences > Ligands > Transporters > Epiblastin…
AI-3
Product Name : AI-3Synonym : Chemical Name : CAS NO.: 882288-28-0Molecular formula : C11H13ClO3S2Molecular Weight: 292.8 g/molClassification : MedChemExpress Products > Life Sciences > AI-3Description: AI-3 is a broad-spectrum antimicrobial…
Duoperone
Product Name : DuoperoneDescription:Duoperone is a neuroleptic agent and also a antiemetic agent in animal models.CAS: 62030-88-0Molecular Weight:514.58Formula: C28H26F4N2OSChemical Name: 10-{3-propyl}-2-(trifluoromethyl)-10H-phenothiazineSmiles : O=C(C1CCN(CCCN2C3=CC(=CC=C3SC3=CC=CC=C23)C(F)(F)F)CC1)C1=CC=C(F)C=C1InChiKey: XMUZRUCADGTCPX-UHFFFAOYSA-NInChi : InChI=1S/C28H26F4N2OS/c29-22-9-6-19(7-10-22)27(35)20-12-16-33(17-13-20)14-3-15-34-23-4-1-2-5-25(23)36-26-11-8-21(18-24(26)34)28(30,31)32/h1-2,4-11,18,20H,3,12-17H2Purity: ≥98% (or refer to…
Parishin E
Product Name : Parishin EDescription:Parishin E, a parishin derivative isolated from Gastrodia elata, may have antioxidant property.CAS: 952068-57-4Molecular Weight:460.39Formula: C19H24O13Chemical Name: 2-hydroxy-2-{2-oxo-2-oxy}phenyl)methoxy]ethyl}butanedioic acidSmiles : OC1O(OC2C=CC(COC(=O)CC(O)(CC(O)=O)C(O)=O)=CC=2)(O)(O)1OInChiKey: XAIUTKHLNZBMEG-HUNOYVTQSA-NInChi : InChI=1S/C19H24O13/c20-7-11-14(24)15(25)16(26)17(32-11)31-10-3-1-9(2-4-10)8-30-13(23)6-19(29,18(27)28)5-12(21)22/h1-4,11,14-17,20,24-26,29H,5-8H2,(H,21,22)(H,27,28)/t11-,14-,15+,16-,17-,19?/m1/s1Purity: ≥98% (or…
2-[1-(4-Chlorophenyl)-2,5-dimethyl-1H-pyrrol-3-yl]acetic acid
Product Name : 2-acetic acidSynonym : Chemical Name : CAS NO.: 42779-82-8Molecular formula : C14H14ClNO2Molecular Weight: 263.72 g/molClassification : MedChemExpress Products > Research Chemicals > 2-acetic acidDescription: 2-acetic acid is…
Sphingosine-1-Phosphate (d17:1)
Product Name : Sphingosine-1-Phosphate (d17:1)Synonym : Chemical Name : CAS NO.: 474923-27-8Molecular formula : C17H36NO5PMolecular Weight: 365.45 g/molClassification : MedChemExpress Products > Research Chemicals > Sphingosine-1-Phosphate (d17:1)Description: Sphingosine-1-Phosphate (d17:1) is…
Iloperidone hydrochloride
Product Name : Iloperidone hydrochlorideSynonym : Chemical Name : CAS NO.: 1299470-39-5Molecular formula : C24H28ClFN2O4Molecular Weight: 462.9 g/molClassification : MedChemExpress Products > Life Sciences > Ligands > Iloperidone hydrochlorideDescription: Iloperidone…
Fructo-oligosaccharide DP7/GF6
Product Name : Fructo-oligosaccharide DP7/GF6Description:Fructo-oligosaccharide DP7/GF6 belongs to fructooligosaccharides (FOS) with degree of polymerization (DP=7). Fructo-oligosaccharides (FOS) are composed of 6 fructose units linked by (2→1)-β-glycosidic bonds and having a…
4”-methyloxy-Genistin
Product Name : 4''-methyloxy-GenistinDescription:4''-methyloxy-Genistin, an isoflavone methyl-glycoside, is isolated from Cordyceps militaris grown on germinated soybeans. Isoflavones possess immunomodulating and antiallergic activities.CAS: 950910-16-4Molecular Weight:446.40Formula: C22H22O10Chemical Name: 7-{oxy}-5-hydroxy-3-(4-hydroxyphenyl)-4H-chromen-4-oneSmiles : CO1(CO)O(OC2=CC3OC=C(C(=O)C=3C(O)=C2)C2C=CC(O)=CC=2)(O)1OInChiKey: DQFZFJHZGAOITN-YCDQRNBNSA-NInChi…
ONC206
Product Name : ONC206Synonym : Chemical Name : CAS NO.: 1638178-87-6Molecular formula : C23H22F2N4OMolecular Weight: 408.4 g/molClassification : MedChemExpress Products > Life Sciences > ONC206Description: ONC206 is a human mitochondrial-derived…
Simeprevir
Product Name : SimeprevirSynonym : Chemical Name : CAS NO.: 923604-59-5Molecular formula : C38H47N5O7S2Molecular Weight: 749.94 g/molClassification : MedChemExpress Products > Antimicrobials > Antivirals > SimeprevirDescription: Anti-viral; NS3/4A protease inhibitor_x005f_x000D_Purity…
Liquidambaric Lactone
Product Name : Liquidambaric LactoneSynonym : Chemical Name : CAS NO.: 185051-75-6Molecular formula : C30H44O4Molecular Weight: 468.67 g/molClassification : MedChemExpress Products > Research Chemicals > Liquidambaric LactoneDescription: Liquidambaric Lactone is…
Clonixin
Product Name : ClonixinDescription:Clonixin (SCH-10304) is an orally active analgesic and a non-steroidal anti-inflammatory agent in rodents.CAS: 17737-65-4Molecular Weight:262.69Formula: C13H11ClN2O2Chemical Name: 2-pyridine-3-carboxylic acidSmiles : CC1=C(Cl)C=CC=C1NC1=NC=CC=C1C(O)=OInChiKey: CLOMYZFHNHFSIQ-UHFFFAOYSA-NInChi : InChI=1S/C13H11ClN2O2/c1-8-10(14)5-2-6-11(8)16-12-9(13(17)18)4-3-7-15-12/h2-7H,1H3,(H,15,16)(H,17,18)Purity: ≥98% (or…
L-alpha-Difluoromethylornithine
Product Name : L-alpha-DifluoromethylornithineSynonym : Chemical Name : CAS NO.: 66640-93-5Molecular formula : C6H12F2N2O2Molecular Weight: 182.17 g/molClassification : MedChemExpress Products > Research Chemicals > L-alpha-DifluoromethylornithineDescription: Eflornithine hydrochloride is a drug…
4-Ethyl-2,6-bis(3-pyridinylmethylene)-cyclohexanone
Product Name : 4-Ethyl-2,6-bis(3-pyridinylmethylene)-cyclohexanoneSynonym : Chemical Name : CAS NO.: 296792-62-6Molecular formula : C20H20N2OMolecular Weight: 304.39 g/molClassification : MedChemExpress Products > Life Sciences > Ligands > 4-Ethyl-2,6-bis(3-pyridinylmethylene)-cyclohexanoneDescription: 4-Ethyl-2,6-bis(3-pyridinylmethylene)-cyclohexanone (MBPC) is…
Leukotriene B4
Product Name : Leukotriene B4Synonym : Chemical Name : CAS NO.: 71160-24-2Molecular formula : C20H32O4Molecular Weight: 336.47 g/molClassification : MedChemExpress Products > Research Chemicals > Leukotriene B4Description: Leukotriene B4 is…
Diflucortolone valerate
Product Name : Diflucortolone valerateDescription:Diflucortolone valerate is a powerful corticosteroid used topically for the research of various skin diseases.CAS: 59198-70-8Molecular Weight:478.57Formula: C27H36F2O5Chemical Name: 2-phenanthren-1-yl]-2-oxoethyl pentanoateSmiles : C1C23C(F)C4=CC(=O)C=C4(C)3(F)(O)C2(C)1C(=O)COC(=O)CCCCInChiKey: HHJIUUAMYGBVSD-YTFFSALGSA-NInChi : InChI=1S/C27H36F2O5/c1-5-6-7-23(33)34-14-21(31)24-15(2)10-17-18-12-20(28)19-11-16(30)8-9-26(19,4)27(18,29)22(32)13-25(17,24)3/h8-9,11,15,17-18,20,22,24,32H,5-7,10,12-14H2,1-4H3/t15-,17+,18+,20+,22+,24-,25+,26+,27+/m1/s1Purity:…
Homoisovanillic acid
Product Name : Homoisovanillic acidSynonym : 3-Hydroxy-4-methoxyphenylacetic acidChemical Name : CAS NO.: 1131-94-8Molecular formula : C9H10O4Molecular Weight: 182.17 g/molClassification : MedChemExpress Products > Research Chemicals > Homoisovanillic acidDescription: Homoisovanillic acid…
1-Benzoylacetone
Product Name : 1-BenzoylacetoneSynonym : 1-Phenyl-butane-1,3-dioneChemical Name : CAS NO.: 93-91-4Molecular formula : C10H10O2Molecular Weight: 162.19 g/molClassification : MedChemExpress Products > Research Chemicals > 1-BenzoylacetoneDescription: 1-Benzoylacetone is a fluorescence probe…
3,4,5-Trimethoxybenzoic acid 8-(diethylamino)octyl ester, hydrochloride
Product Name : 3,4,5-Trimethoxybenzoic acid 8-(diethylamino)octyl ester, hydrochlorideSynonym : TMB-8Chemical Name : CAS NO.: 53464-72-5Molecular formula : C22H38ClNO5Molecular Weight: 431.99 g/molClassification : MedChemExpress Products > Research Chemicals > 3,4,5-Trimethoxybenzoic acid…
KRN5
Product Name : KRN5Description:KRN5, a derivative of KRN2, is an oral active Nuclear factor of activated T cells 5 (NFAT5) suppressor, with an IC50 of 750 nM. KRN5 has potential…
4,5-Dichlorocatechol
Product Name : 4,5-DichlorocatecholSynonym : 4,5-Dichloropyrocatechol4,5-Dichloro-1,2-benzenediol4,5-Dichloro-1,2-dihydroxybenzeneChemical Name : CAS NO.: 3428-24-8Molecular formula : C6H4Cl2O2Molecular Weight: 179 g/molClassification : MedChemExpress Products > Research Chemicals > 4,5-DichlorocatecholDescription: 4,5-Dichlorocatechol is used for the…
2,3,5,6-Tetra-methyl-pyrazine
Product Name : 2,3,5,6-Tetra-methyl-pyrazineSynonym : Chemical Name : CAS NO.: 1124-11-4Molecular formula : C8H12N2Molecular Weight: 136.19 g/molClassification : MedChemExpress Products > Research Chemicals > 2,3,5,6-Tetra-methyl-pyrazineDescription: 2,3,5,6-Tetra-methyl-pyrazine is a chemical compound…
Pitolisant hydrochloride – Bio-X ™
Product Name : Pitolisant hydrochloride - Bio-X ™Synonym : Pitolisant HCl BF 2649Chemical Name : CAS NO.: 903576-44-3Molecular formula : C17H26ClNO·HClMolecular Weight: 332.31 g/molClassification : MedChemExpress Products > Life Sciences…
Asenapine Hydrochloride
Product Name : Asenapine HydrochlorideDescription:Asenapine, also known as Org 5222 and HSDB 8061, shows high affinity (pKi) for numerous receptors, including the serotonin 5-HT1A (8.6), 5-HT1B (8.4), 5-HT2A (10.2), 5-HT2B…
5(6)-carboxyfluorescein diacetate
Product Name : 5(6)-carboxyfluorescein diacetateSynonym : Chemical Name : CAS NO.: 124387-19-5Molecular formula : C25H16O9Molecular Weight: 460.39 g/molClassification : MedChemExpress Products > Research Chemicals > 5(6)-carboxyfluorescein diacetateDescription: 5(6)-carboxyfluorescein diacetate is…
Acacetin 7-O-methyl ether
Product Name : Acacetin 7-O-methyl etherSynonym : 4',7-Dimethoxy-5-hydroxyflavone4',7-O-Dimethylapigenin, 4',7-DimethoxyapigeninApigenin-4',7-di-O-methyl etherChemical Name : CAS NO.: 5128-44-9Molecular formula : C17H14O5Molecular Weight: 298.29 g/molClassification : MedChemExpress Products > Natural Products > Flavonoids >…
CPPHA
Product Name : CPPHASynonym : N-phenyl]-2-hydroxybenzamideChemical Name : CAS NO.: 693288-97-0Molecular formula : C22H15ClN2O4Molecular Weight: 406.82 g/molClassification : MedChemExpress Products > Life Sciences > CPPHADescription: Positive allosteric modulator of mGlu1 and…
Pep1-AGL
Product Name : Pep1-AGLDescription:Product informationCAS: Molecular Weight:960.11Formula: C40H69N11O14SChemical Name: 2-acetamido}-4-(methylsulfanyl)butanoyl)pyrrolidin-2-yl]formamido}-4-methylpentanamido)acetamido]propanamido}propanamido)acetamido]-4-methylpentanoic acidSmiles : CSCCC(NC(=O)CNC(=O)C(CO)NC(=O)C(N)CO)C(=O)N1CCCC1C(=O)NC(CC(C)C)C(=O)NCC(=O)NC(C)C(=O)NC(C)C(=O)NCC(=O)NC(CC(C)C)C(O)=OInChiKey: DKRJFJKDHRZRQJ-UHFFFAOYSA-NInChi : InChI=1S/C40H69N11O14S/c1-20(2)13-26(36(60)43-15-30(54)45-23(6)34(58)46-22(5)33(57)42-16-32(56)48-27(40(64)65)14-21(3)4)49-38(62)29-9-8-11-51(29)39(63)25(10-12-66-7)47-31(55)17-44-37(61)28(19-53)50-35(59)24(41)18-52/h20-29,52-53H,8-19,41H2,1-7H3,(H,42,57)(H,43,60)(H,44,61)(H,45,54)(H,46,58)(H,47,55)(H,48,56)(H,49,62)(H,50,59)(H,64,65)Purity: ≥98% (or refer to the Certificate of Analysis)Shipping Condition: Shipped under ambient temperature as…
Dapsone-13C12
Product Name : Dapsone-13C12Synonym : Chemical Name : CAS NO.: 1632119-29-9Molecular formula : ¹³C12H12N2O2SMolecular Weight: 260.3 g/molClassification : MedChemExpress Products > Research Chemicals > Dapsone-13C12Description: Dapsone-13C12 is a synthetic derivative…
Ribocil
Product Name : RibocilSynonym : Chemical Name : CAS NO.: 1381289-58-2Molecular formula : C19H22N6OSMolecular Weight: 382.48 g/molClassification : MedChemExpress Products > Research Chemicals > RibocilDescription: Ribocil is a chemical that…
Tetrahydrouridine
Product Name : TetrahydrouridineSynonym : Chemical Name : CAS NO.: 18771-50-1Molecular formula : C9H16N2O6Molecular Weight: 248.23 g/molClassification : MedChemExpress Products > Nucleosides > Nucleosides, Nucleotides and Nucleic acids > TetrahydrouridineDescription:…
OSU 6162 hydrochloride
Product Name : OSU 6162 hydrochlorideDescription:Product informationCAS: 156907-84-5Molecular Weight:317.87Formula: C15H24ClNO2SChemical Name: (3S)-3-(3-methanesulfonylphenyl)-1-propylpiperidine hydrochlorideSmiles : Cl.CCCN1C(CCC1)C1C=C(C=CC=1)S(C)(=O)=OInChiKey: LEMGVHZVBREXAD-PFEQFJNWSA-NInChi : InChI=1S/C15H23NO2S.ClH/c1-3-9-16-10-5-7-14(12-16)13-6-4-8-15(11-13)19(2,17)18;/h4,6,8,11,14H,3,5,7,9-10,12H2,1-2H3;1H/t14-;/m1./s1Purity: ≥98% (or refer to the Certificate of Analysis)Shipping Condition: Shipped under ambient…
ICI 63197
Product Name : ICI 63197Description:Product informationCAS: 27277-00-5Molecular Weight:207.23Formula: C9H13N5OChemical Name: 2-amino-6-methyl-4-propyl-4H,5H-triazolopyrimidin-5-oneSmiles : CC1=CN2N=C(N)N=C2N(CCC)C1=OInChiKey: UQDVRVNMIJAGRK-UHFFFAOYSA-NInChi : InChI=1S/C9H13N5O/c1-3-4-13-7(15)6(2)5-14-9(13)11-8(10)12-14/h5H,3-4H2,1-2H3,(H2,10,12)Purity: ≥98% (or refer to the Certificate of Analysis)Shipping Condition: Shipped under ambient temperature as…
Neobritannilactone B
Product Name : Neobritannilactone BSynonym : Chemical Name : CAS NO.: 886990-00-7Molecular formula : C15H20O3Molecular Weight: 248.32 g/molClassification : MedChemExpress Products > Natural Products > Neobritannilactone BDescription: Neobritannilactone B is…
(R)-6-(4-Aminophenyl)-4,5-dihydro-5-methyl-3(2H)-pyridazinone
Product Name : (R)-6-(4-Aminophenyl)-4,5-dihydro-5-methyl-3(2H)-pyridazinoneSynonym : (5R)-6-(4-Aminophenyl)-4,5-dihydro-5-methyl-3(2H)-pyridazinoneOR-1855Chemical Name : CAS NO.: 101328-85-2Molecular formula : C11H13N3OMolecular Weight: 203.24 g/molClassification : MedChemExpress Products > Research Chemicals >Fine Chemicals > (R)-6-(4-Aminophenyl)-4,5-dihydro-5-methyl-3(2H)-pyridazinoneDescription: (R)-6-(4-Aminophenyl)-4,5-dihydro-5-methyl-3(2H)-pyridazinone is an…
3-Hydroxy desloratadine
Product Name : 3-Hydroxy desloratadineSynonym : 8-Chloro-6,11-dihydro-11-(4-piperidinylidene)-5H-benzocycloheptapyridin-3-ol3-HydroxydesloratadineSch 45581Chemical Name : CAS NO.: 119410-08-1Molecular formula : C19H19ClN2OMolecular Weight: 326.82 g/molClassification : MedChemExpress Products > Research Chemicals > 3-Hydroxy desloratadineDescription: 3-Hydroxy desloratadine…
2-Guanidinoethylmercaptosuccinic Acid
Product Name : 2-Guanidinoethylmercaptosuccinic AcidDescription:Ki: 8.8 nM 2-Guanidinoethylmercaptosuccinic acid is a carboxypeptidase E inhibitor. Carboxypeptidase E, also known as enkephalin convertase, can remove C-terminal residues during the processing of propeptides,…
5-Chlorothiophene-2-carboxylic acid
Product Name : 5-Chlorothiophene-2-carboxylic acidSynonym : Chemical Name : CAS NO.: 24065-33-6Molecular formula : C5H3ClO2SMolecular Weight: 162.59 g/molClassification : MedChemExpress Products > Research Chemicals > 5-Chlorothiophene-2-carboxylic acidDescription: Intermediate in the…
3-Aminopropionitrile fumarate
Product Name : 3-Aminopropionitrile fumarateSynonym : Chemical Name : CAS NO.: 2079-89-2Molecular formula : C10H16N4O4Molecular Weight: 256.26 g/molClassification : MedChemExpress Products > Research Chemicals >Fine Chemicals > 3-Aminopropionitrile fumarateDescription: 3-Aminopropionitrile…
Teplizumab
Product Name : TeplizumabSynonym : Chemical Name : CAS NO.: 876387-05-2Molecular formula : Molecular Weight: Classification : MedChemExpress Products > Life Sciences > Antibodies > Monoclonal Antibodies > TeplizumabDescription: Anti-Human…
BML-190
Product Name : BML-190Description:BML-190, also known as IMMA and LM-4131 or Indomethacin Morpholinylamide, is selective CB2 receptor agonist. The binding constant for the CB2 receptor is 435 nM compared to…
Glucoraphanin
Product Name : GlucoraphaninSynonym : Sulforaphane glucosinolateChemical Name : CAS NO.: 21414-41-5Molecular formula : C12H23NO10S3Molecular Weight: 437.51 g/molClassification : MedChemExpress Products > Natural Products > GlucoraphaninDescription: Glucoraphanin is a chemical…
Cetirizine methyl ester
Product Name : Cetirizine methyl esterSynonym : Methyl 2--1-piperazinyl]ethoxy]acetate-1-piperazinyl]ethoxy ]-acetic acid methyl esterChemical Name : CAS NO.: 83881-46-3Molecular formula : C22H27ClN2O3Molecular Weight: 402.91 g/molClassification : MedChemExpress Products > Research Chemicals…
7-Hydroxy warfarin-d5
Product Name : 7-Hydroxy warfarin-d5Synonym : Chemical Name : CAS NO.: 94820-65-2Molecular formula : C19H16O5Molecular Weight: 329.4 g/molClassification : MedChemExpress Products > Research Chemicals > 7-Hydroxy warfarin-d5Description: 7-Hydroxy warfarin-d5 is…
Propargyl-PEG4-methylamine
Product Name : Propargyl-PEG4-methylamineSynonym : Chemical Name : CAS NO.: 1807530-11-5Molecular formula : C12H23NO4Molecular Weight: 245.32 g/molClassification : MedChemExpress Products > PEG Polymers > Propargyl-PEG4-methylamineDescription: Propargyl-PEG4-methylamine is a PEG product…
6-Gingerol
Product Name : 6-GingerolSynonym : (S)-5-Hydroxy-1-(4-hydroxy-3-methoxyphenyl)-3-decanoneChemical Name : CAS NO.: 23513-14-6Molecular formula : C17H26O4Molecular Weight: 294.39 g/molClassification : MedChemExpress Products > Natural Products > 6-GingerolDescription: 6-Gingerol is a natural compound…
D-Cycloserine
Product Name : D-CycloserineSynonym : D-4-Amino-3-isoxazolidinoneChemical Name : CAS NO.: 68-41-7Molecular formula : C3H6N2O2Molecular Weight: 102.09 g/molClassification : MedChemExpress Products > Antimicrobials > Antibiotics > D-CycloserineDescription: D-Cycloserine is a molecule…
Eucamalduside A
Product Name : Eucamalduside ASynonym : Chemical Name : CAS NO.: 1287220-29-4Molecular formula : C26H32O11Molecular Weight: 520.5 g/molClassification : MedChemExpress Products > Natural Products > Eucamalduside ADescription: Eucamalduside A is…
Melatonin-d4
Product Name : Melatonin-d4Synonym : Chemical Name : CAS NO.: 66521-38-8Molecular formula : C13H16N2O2Molecular Weight: 236.3 g/molClassification : MedChemExpress Products > Research Chemicals > Melatonin-d4Description: Melatonin-d4 is a high-quality synthetic…
EC 144
Product Name : EC 144Synonym : Chemical Name : CAS NO.: 911397-80-3Molecular formula : C21H24ClN5O2Molecular Weight: 413.9 g/molClassification : MedChemExpress Products > Life Sciences > EC 144Description: EC 144 is…
H-Cys-Val-2-Nal-Met-OH TFA salt
Product Name : H-Cys-Val-2-Nal-Met-OH TFA saltSynonym : Chemical Name : CAS NO.: 158022-12-9Molecular formula : C26H36N4O5S2•C2HF3O2Molecular Weight: 662.74 g/molClassification : MedChemExpress Products > Research Chemicals > H-Cys-Val-2-Nal-Met-OH TFA saltDescription: H-Cys-Val-2-Nal-Met-OH…
(R)-Mesopram
Product Name : (R)-MesopramSynonym : Chemical Name : CAS NO.: 189940-24-7Molecular formula : C14H19NO4Molecular Weight: 265.31 g/molClassification : MedChemExpress Products > Research Chemicals > (R)-MesopramDescription: Mesopram is a prodrug of…
Nicergoline – Bio-X ™
Product Name : Nicergoline - Bio-X ™Synonym : 5-Bromonicotinic acid 10-methoxy-1,6-dimethylergoline-8-methyl estermethyl 5-bromopyr idine-3-carboxylateChemical Name : CAS NO.: 27848-84-6Molecular formula : C24H26BrN3O3Molecular Weight: 484.39 g/molClassification : MedChemExpress Products > Life…
Tafluprost
Product Name : TafluprostSynonym : (5Z)-7--3,5-dihydroxycyclopentyl]-5-heptenoic acid 1-methylethyl esterChemical Name : CAS NO.: 209860-87-7Molecular formula : C25H34F2O5Molecular Weight: 452.53 g/molClassification : MedChemExpress Products > Life Sciences > Ligands > Prostanoid…
Bifenthrin,mixture of enantiomers
Product Name : Bifenthrin,mixture of enantiomersSynonym : Chemical Name : CAS NO.: 82657-04-3Molecular formula : C23H22ClF3O2Molecular Weight: 422.87 g/molClassification : MedChemExpress Products > Research Chemicals > Bifenthrin,mixture of enantiomersDescription: Bifenthrin…
Clavulanic acid
Product Name : Clavulanic acidSynonym : Chemical Name : CAS NO.: 58001-44-8Molecular formula : C8H9NO5Molecular Weight: 199.16 g/molClassification : MedChemExpress Products > Research Chemicals > Clavulanic acidDescription: Clavulanic acid is…
VEGFR Tyrosine Kinase Inhibitor VI, AAL-993
Product Name : VEGFR Tyrosine Kinase Inhibitor VI, AAL-993Synonym : Chemical Name : CAS NO.: 269390-77-4Molecular formula : C20H16F3N3OMolecular Weight: 371.36 g/molClassification : MedChemExpress Products > Research Chemicals > VEGFR…
Cytostat
Product Name : CytostatSynonym : Chemical Name : CAS NO.: 25875-51-8Molecular formula : C15H13Cl2N5Molecular Weight: 334.2 g/molClassification : MedChemExpress Products > Life Sciences > CytostatDescription: Cytostat is a research tool…
Protopseudohypericin
Product Name : ProtopseudohypericinSynonym : Chemical Name : CAS NO.: 54328-09-5Molecular formula : C30H18O9Molecular Weight: 522.5 g/molClassification : MedChemExpress Products > Natural Products > ProtopseudohypericinDescription: Protopseudohypericin is a mixture of…
4-Desmethyl istradefylline
Product Name : 4-Desmethyl istradefyllineSynonym : Chemical Name : CAS NO.: 160434-48-0Molecular formula : C19H22N4O4Molecular Weight: 370.4 g/molClassification : MedChemExpress Products > Life Sciences > 4-Desmethyl istradefyllineDescription: 4-Desmethyl istradefylline is…
6-Methylcoumarin
Product Name : 6-MethylcoumarinSynonym : Chemical Name : CAS NO.: 92-48-8Molecular formula : C10H8O2Molecular Weight: 160.17 g/molClassification : MedChemExpress Products > Natural Products > Coumarins > 6-MethylcoumarinDescription: The 6-methylcoumarin is…
Alpertine
Product Name : AlpertineSynonym : Chemical Name : CAS NO.: 27076-46-6Molecular formula : C25H31N3O4Molecular Weight: 437.5 g/molClassification : MedChemExpress Products > Life Sciences > AlpertineDescription: Alpertine is a pharmaceutical preparation…
Pilocarpine
Product Name : PilocarpineSynonym : Ocusert piloChemical Name : CAS NO.: 92-13-7Molecular formula : C11H16N2O2Molecular Weight: 208.26 g/molClassification : MedChemExpress Products > Natural Products > PilocarpineDescription: Pilocarpine is a cholinergic…
Mc-Val-Ala-pbd
Product Name : Mc-Val-Ala-pbdSynonym : Chemical Name : CAS NO.: 1342820-51-2Molecular formula : C60H64N8O12Molecular Weight: 1,089.2 g/molClassification : MedChemExpress Products > Life Sciences > Mc-Val-Ala-pbdDescription: Mc-Val-Ala-pbd is a potent anticancer…
SF-22
Product Name : SF-22Synonym : Chemical Name : CAS NO.: 824981-55-7Molecular formula : C28H26N2O3SMolecular Weight: 470.6 g/molClassification : MedChemExpress Products > Life Sciences > Ligands > SF-22Description: SF-22 is a…
WH-4-023
Product Name : WH-4-023Synonym : Chemical Name : CAS NO.: 837422-57-8Molecular formula : C32H36N6O4Molecular Weight: 568.67 g/molClassification : MedChemExpress Products > Research Chemicals > WH-4-023Description: WH-4-023 is a molecule that…
RIPGBMNew
Product Name : RIPGBMNewSynonym : Chemical Name : CAS NO.: 355406-76-7Molecular formula : C26H21FN2O3Molecular Weight: 428.46 g/molClassification : MedChemExpress Products > Research Chemicals > RIPGBMNewDescription: RIPGBMNew is a recombinant human…
Stearic acid
Product Name : Stearic acidSynonym : Chemical Name : CAS NO.: 57-11-4Molecular formula : C18H36O2Molecular Weight: 284.48 g/molClassification : MedChemExpress Products > Research Chemicals > Stearic acidDescription: Stearic acid is…
Fura red, am
Product Name : Fura red, amSynonym : Chemical Name : CAS NO.: 149732-62-7Molecular formula : C41H44N4O20SMolecular Weight: 944.9 g/molClassification : MedChemExpress Products > Impurities > Fura red, amDescription: Fura Red,…
Stigmasta-4,22-dien-3-one
Product Name : Stigmasta-4,22-dien-3-oneSynonym : Chemical Name : CAS NO.: 20817-72-5Molecular formula : C29H46OMolecular Weight: 410.67 g/molClassification : MedChemExpress Products > Controlled Products > Stigmasta-4,22-dien-3-oneDescription: Stigmasta-4,22-dien-3-one is a natural product…
Ginsenoside RS1
Product Name : Ginsenoside RS1Synonym : Chemical Name : CAS NO.: 87733-67-3Molecular formula : C55H92O23Molecular Weight: 1,121.3 g/molClassification : MedChemExpress Products > Natural Products > Ginsenoside RS1Description: Ginsenoside RS1 is…
PF-03049423
Product Name : PF-03049423Synonym : Chemical Name : CAS NO.: 402955-58-2Molecular formula : C24H33ClN6O4Molecular Weight: 505 g/molClassification : MedChemExpress Products > Life Sciences > PF-03049423Description: PF-03049423 is a drug that…
TMEM16A Inhibitor, T16Ainh-A01
Product Name : TMEM16A Inhibitor, T16Ainh-A01Synonym : Chemical Name : CAS NO.: 552309-42-9Molecular formula : C19H20N4O3S2Molecular Weight: 416.52 g/molClassification : MedChemExpress Products > Research Chemicals > TMEM16A Inhibitor, T16Ainh-A01Description: Tmem16a…
GSK-3368715
Product Name : GSK-3368715Synonym : Chemical Name : CAS NO.: 1629013-22-4Molecular formula : C20H38N4O2Molecular Weight: 366.55 g/molClassification : MedChemExpress Products > Life Sciences > GSK-3368715Description: GSK-3368715 is an experimental drug…
Arachidonic acid – 90%
Product Name : Arachidonic acid - 90%Synonym : Chemical Name : CAS NO.: 506-32-1Molecular formula : C20H32O2Molecular Weight: 304.47 g/molClassification : MedChemExpress Products > Research Chemicals >Fine Chemicals > Arachidonic…
BioA-IN-13
Product Name : BioA-IN-13Synonym : Chemical Name : CAS NO.: 1164475-61-9Molecular formula : C19H16N2O4SMolecular Weight: 368.41 g/molClassification : MedChemExpress Products > Life Sciences > BioA-IN-13Description: BioA-IN-13 is a peptide that…
4-([7-Chloro-4-quinolinyl]amino)-2-([diethylamino]methyl)phenol dihydrochloride dihydrate
Product Name : 4-(amino)-2-(methyl)phenol dihydrochloride dihydrateSynonym : AmodiaQuine dihydrochloride dihydrateChemical Name : CAS NO.: 6398-98-7Molecular formula : Molecular Weight: Classification : MedChemExpress Products > Research Chemicals >Fine Chemicals > 4-(amino)-2-(methyl)phenol…
Kuraridine
Product Name : KuraridineSynonym : Chemical Name : CAS NO.: 34981-25-4Molecular formula : C26H30O6Molecular Weight: 438.5 g/molClassification : MedChemExpress Products > Life Sciences > KuraridineDescription: Kuraridine is a peptide that…
GNE-317
Product Name : GNE-317Synonym : Chemical Name : CAS NO.: 1394076-92-6Molecular formula : C19H22N6O3SMolecular Weight: 414.48 g/molClassification : MedChemExpress Products > Life Sciences > GNE-317Description: GNE-317 is a cancer therapeutic…
Kushenol A
Product Name : Kushenol ASynonym : Chemical Name : CAS NO.: 99217-63-7Molecular formula : Molecular Weight: Classification : MedChemExpress Products > Research Chemicals > Kushenol ADescription: Kushenol A is a…
Cy5-NHS trimethylamine salt
Product Name : Cy5-NHS trimethylamine saltSynonym : Cy5 NHS EsterCy5-SEChemical Name : CAS NO.: 146368-14-1Molecular formula : C37H43N3O10S2Molecular Weight: 753.88 g/molClassification : MedChemExpress Products > Research Chemicals > Cy5-NHS trimethylamine…
PRMT5-IN-3
Product Name : PRMT5-IN-3Synonym : Chemical Name : CAS NO.: 2159123-14-3Molecular formula : C22H23F3N4O3Molecular Weight: 448.40 g/molClassification : MedChemExpress Products > Natural Products > PRMT5-IN-3Description: PRMT5-IN-3 is a primary metabolite…
1-Methyl-2-nonyl-4-quinolinone
Product Name : 1-Methyl-2-nonyl-4-quinolinoneSynonym : Chemical Name : CAS NO.: 68353-24-2Molecular formula : C19H27NOMolecular Weight: 285.4 g/molClassification : MedChemExpress Products > Natural Products > 1-Methyl-2-nonyl-4-quinolinoneDescription: 1-Methyl-2-nonyl-4-quinolinone is a potent inhibitor…
Verdiperstat
Product Name : VerdiperstatSynonym : Chemical Name : CAS NO.: 890655-80-8Molecular formula : C11H15N3O2SMolecular Weight: 253.32 g/molClassification : MedChemExpress Products > Life Sciences > VerdiperstatDescription: Verdiperstat is an irreversible inhibitor…
PEG 3350 – Average Mw approx 3350
Product Name : PEG 3350 - Average Mw approx 3350Synonym : Poly(ethylene glycol)3350Chemical Name : CAS NO.: 25322-68-3Molecular formula : (C2H4O)n•H2OMolecular Weight: Classification : MedChemExpress Products > Research Chemicals >…
Flavin adenine dinucleotide
Product Name : Flavin adenine dinucleotideSynonym : FAD Riboflavin 5'-adenosineChemical Name : CAS NO.: 146-14-5Molecular formula : C27H33N9O15P2Molecular Weight: 785.5 g/molClassification : MedChemExpress Products > Nucleosides > Flavin adenine dinucleotideDescription:…
L-Aspartic acid diethyl ester hydrochloride
Product Name : L-Aspartic acid diethyl ester hydrochlorideSynonym : H-Asp(OEt)-OEt.HClChemical Name : CAS NO.: 16115-68-7Molecular formula : C8H15NO4Molecular Weight: 189.21 g/molClassification : MedChemExpress Products > Research Chemicals >Fine Chemicals >…
Pf 04671536 hydrochloride
Product Name : Pf 04671536 hydrochlorideSynonym : Chemical Name : CAS NO.: 1305116-67-9Molecular formula : C14H19ClN8OSMolecular Weight: 382.9 g/molClassification : MedChemExpress Products > Life Sciences > Pf 04671536 hydrochlorideDescription: Pf…
PROTO-1
Product Name : PROTO-1Synonym : Chemical Name : CAS NO.: 312951-85-2Molecular formula : C17H19ClN4O2SMolecular Weight: 378.88 g/molClassification : MedChemExpress Products > Research Chemicals > PROTO-1Description: PROTO-1 is a computer program…
Uridine 5′-monophosphate disodium
Product Name : Uridine 5'-monophosphate disodiumSynonym : UMP Disodium5'-UMP Na2D-Uridine 5'-monophosphate disodiumChemical Name : CAS NO.: 3387-36-8Molecular formula : C9H11N2Na2O9PMolecular Weight: 368.15 g/molClassification : MedChemExpress Products > Nucleosides > Nucleosides,…
N-Demethylechitamine
Product Name : N-DemethylechitamineSynonym : Chemical Name : CAS NO.: 60048-88-6Molecular formula : C21H26N2O4Molecular Weight: 370.4 g/molClassification : MedChemExpress Products > Natural Products > N-DemethylechitamineDescription: N-Demethylechitamine is a n-oxide with…
D,L-Venlafaxine
Product Name : D,L-VenlafaxineSynonym : 1-cyclohexanol(+/-)-VenlafaxineTrevilorChemical Name : CAS NO.: 93413-69-5Molecular formula : C17H27NO2Molecular Weight: 277.4 g/molClassification : MedChemExpress Products > Controlled Products > D,L-VenlafaxineDescription: Serotonin and norepinephrine reuptake inhibitor;…
[Tyr0]-C-Peptide (Human)
Product Name : -C-Peptide (Human)Synonym : Chemical Name : CAS NO.: 57327-90-9Molecular formula : C138H220N36O50Molecular Weight: 3,183.5 g/molClassification : MedChemExpress Products > Life Sciences > -C-Peptide (Human)Description: This product is…
Gamithromycin
Product Name : GamithromycinSynonym : (2R,3S,4R,5S,8R,10R,11R,12S,13S,14R)-13--2-ethyl-3,4,10-trihydroxy-3, 5,8,10,12,14-hexamethyl-7-propyl-11-oxy]-1-oxa-7-azacyclopenChemical Name : CAS NO.: 145435-72-9Molecular formula : C40H76N2O12Molecular Weight: 777.04 g/molClassification : MedChemExpress Products > Antimicrobials > Antibiotics > GamithromycinDescription: Gamithromycin is a…
Hydroxocobalamin HCl
Product Name : Hydroxocobalamin HClSynonym : Chemical Name : CAS NO.: 58288-50-9Molecular formula : C62H89CoN13O15P•(HCl)xMolecular Weight: 1,346.35 g/molClassification : MedChemExpress Products > Research Chemicals > Hydroxocobalamin HClDescription: Hydroxocobalamin HCl is…
Leucokinin I
Product Name : Leucokinin ISynonym : Chemical Name : CAS NO.: 104600-89-7Molecular formula : C41H52N11O12Molecular Weight: 890.92 g/molClassification : MedChemExpress Products > Research Chemicals > Leucokinin IDescription: Leucokinin I is…
SIS17 – Bio-X ™
Product Name : SIS17 - Bio-X ™Synonym : Chemical Name : CAS NO.: 2374313-54-7Molecular formula : C21H38N2OSMolecular Weight: 366.6 g/molClassification : MedChemExpress Products > Life Sciences > SIS17 - Bio-X…
Dimethrin
Product Name : DimethrinSynonym : Chemical Name : CAS NO.: 70-38-2Molecular formula : C19H26O2Molecular Weight: 286.4 g/molClassification : MedChemExpress Products > Life Sciences > DimethrinDescription: Dimethrin is a medicinal compound…
4-Hydroxy-3-methoxybenzoic acid ethyl ester
Product Name : 4-Hydroxy-3-methoxybenzoic acid ethyl esterSynonym : Vanillic acid ethyl esterEthyl vanillateChemical Name : CAS NO.: 617-05-0Molecular formula : C10H12O4Molecular Weight: 196.2 g/molClassification : MedChemExpress Products > Research Chemicals…
8-Bromoguanosine
Product Name : 8-BromoguanosineSynonym : 2-Amino-8-bromo-6-hydroxypurine riboside8-Bromo-D-guanosineChemical Name : CAS NO.: 4016-63-1Molecular formula : C10H12BrN5O5Molecular Weight: 362.14 g/molClassification : MedChemExpress Products > Nucleosides > Nucleosides, Nucleotides and Nucleic acids >…
(E/Z)-Endoxifen
Product Name : (E/Z)-EndoxifenSynonym : (E/Z)-4-phenyl]-2-phenyl-1-buten-1-yl]-phenol4-Hydroxy-N-desmethyltamoxifenChemical Name : CAS NO.: 110025-28-0Molecular formula : C25H27NO2Molecular Weight: 373.49 g/molClassification : MedChemExpress Products > Life Sciences > (E/Z)-EndoxifenDescription: Estrogen receptor antagonist; tamoxifen metabolite;…
3,5-Difluoro-alpha-hydroxybenzeneacetic acid 2-(2-ethyl-4-hydroxy-3-methylbenzoyl)hydrazide
Product Name : 3,5-Difluoro-alpha-hydroxybenzeneacetic acid 2-(2-ethyl-4-hydroxy-3-methylbenzoyl)hydrazideSynonym : Chemical Name : CAS NO.: 1181770-72-8Molecular formula : C18H18F2N2O4Molecular Weight: 364.34 g/molClassification : MedChemExpress Products > Research Chemicals > 3,5-Difluoro-alpha-hydroxybenzeneacetic acid 2-(2-ethyl-4-hydroxy-3-methylbenzoyl)hydrazideDescription: 3,5-Difluoro-alpha-hydroxybenzeneacetic…
Cis-clomiphene citrate
Product Name : Cis-clomiphene citrateSynonym : Chemical Name : CAS NO.: 7619-53-6Molecular formula : C32H36ClNO8Molecular Weight: 598.1 g/molClassification : MedChemExpress Products > Life Sciences > Cis-clomiphene citrateDescription: Cis-clomiphene citrate is…
Cis-ned 19
Product Name : Cis-ned 19Synonym : Chemical Name : CAS NO.: 1137264-00-6Molecular formula : C30H31FN4O3Molecular Weight: 514.6 g/molClassification : MedChemExpress Products > Life Sciences > Cis-ned 19Description: Cis-ned 19 is…
Ceplignan
Product Name : CeplignanSynonym : Chemical Name : CAS NO.: 185244-78-4Molecular formula : C18H18O7Molecular Weight: 346.30 g/molClassification : MedChemExpress Products > Natural Products > CeplignanDescription: Ceplignan is a natural product…
BTSA1
Product Name : BTSA1Synonym : Chemical Name : CAS NO.: 314761-14-3Molecular formula : C21H14N6OS2Molecular Weight: 430.51 g/molClassification : MedChemExpress Products > Life Sciences > BTSA1Description: BTSA1 is a cytosolic protein…
N-(4-Chlorophenyl)-1,3,5-triazine-2,4-diamine
Product Name : N-(4-Chlorophenyl)-1,3,5-triazine-2,4-diamineSynonym : 1,3,5-triazine-2,4-diamine, N-(4-chlorophenyl)-Chemical Name : CAS NO.: 500-42-5Molecular formula : C9H8ClN5Molecular Weight: 221.65 g/molClassification : MedChemExpress Products > Research Chemicals > N-(4-Chlorophenyl)-1,3,5-triazine-2,4-diamineDescription: N-(4-Chlorophenyl)-1,3,5-triazine-2,4-diamine is a chemical…
Micromelin
Product Name : MicromelinSynonym : Chemical Name : CAS NO.: 15085-71-9Molecular formula : C15H12O6Molecular Weight: 288.25 g/molClassification : MedChemExpress Products > Natural Products > MicromelinDescription: Micromelin is an indole alkaloid…
H-Thr-Met-OH
Product Name : H-Thr-Met-OHSynonym : Chemical Name : CAS NO.: 90729-28-5Molecular formula : C9H18N2O4SMolecular Weight: 250.32 g/molClassification : MedChemExpress Products > Research Chemicals > H-Thr-Met-OHDescription: H-Thr-Met-OH is a dinitrophenylated amino…
5-(4-Fluorophenyl)-1-(4-Methylsulfonylphenyl)-3-(Trifluoromethyl)Pyrazole
Product Name : 5-(4-Fluorophenyl)-1-(4-Methylsulfonylphenyl)-3-(Trifluoromethyl)PyrazoleSynonym : Chemical Name : CAS NO.: 162054-19-5Molecular formula : C17H12F4N2O2SMolecular Weight: 384.35 g/molClassification : MedChemExpress Products > Research Chemicals > 5-(4-Fluorophenyl)-1-(4-Methylsulfonylphenyl)-3-(Trifluoromethyl)PyrazoleDescription: 5-(4-Fluorophenyl)-1-(4-methylsulfonylphenyl)-3-(trifluoromethyl)pyrazole is a fatty acid…
Quercetin 3-b-galactoside-2′-O-gallate
Product Name : Quercetin 3-b-galactoside-2'-O-gallateSynonym : 2''-O-Galloyl-hyperin2-(3,4-Dihydroxyphenyl)-5,7-dihydroxy-3--4H-1-benzopy ran-4-oneChemical Name : CAS NO.: 53209-27-1Molecular formula : C28H24O16Molecular Weight: 616.48 g/molClassification : MedChemExpress Products > Carbohydrates > Monosaccharides > Quercetin 3-b-galactoside-2'-O-gallateDescription: Quercetin…
bc-1382
Product Name : bc-1382Synonym : Chemical Name : CAS NO.: 1013753-99-5Molecular formula : C23H29N3O5SMolecular Weight: 459.56 g/molClassification : MedChemExpress Products > Life Sciences > bc-1382Description: The compound bc-1382 is a…
Sb 206553 hydrochloride
Product Name : Sb 206553 hydrochlorideSynonym : Chemical Name : CAS NO.: 158942-04-2Molecular formula : C17H16N4OMolecular Weight: 292.33 g/molClassification : MedChemExpress Products > Life Sciences > Sb 206553 hydrochlorideDescription: Sb…
Isosteviol
Product Name : IsosteviolSynonym : (4α,8β,13β)-13-Methyl-16-oxo-17-norkauran-18-oic acidChemical Name : CAS NO.: 27975-19-5Molecular formula : C20H30O3Molecular Weight: 318.45 g/molClassification : MedChemExpress Products > Natural Products > Terpenes > IsosteviolDescription: Isosteviol is…
GRK2-IN-1 hydrochloride
Product Name : GRK2-IN-1 hydrochlorideSynonym : Chemical Name : CAS NO.: 2055990-90-2Molecular formula : C24H25FN4O4Molecular Weight: 452.5 g/molClassification : MedChemExpress Products > Life Sciences > GRK2-IN-1 hydrochlorideDescription: GRK2-IN-1 hydrochloride is…
Rivulobirin B
Product Name : Rivulobirin BSynonym : Chemical Name : CAS NO.: 194145-29-4Molecular formula : C23H12O9Molecular Weight: 432.3 g/molClassification : MedChemExpress Products > Natural Products > Rivulobirin BDescription: Rivulobirin B is…
N6-(1-Iminoethyl)-L-lysine hydrochloride
Product Name : N6-(1-Iminoethyl)-L-lysine hydrochlorideSynonym : N6-(1-Iminoethyl)-L-lysine monohydrochlorideL-NILChemical Name : CAS NO.: 150403-89-7Molecular formula : C8H18ClN3O2Molecular Weight: 223.7 g/molClassification : MedChemExpress Products > Research Chemicals > N6-(1-Iminoethyl)-L-lysine hydrochlorideDescription: N6-(1-Iminoethyl)-L-lysine hydrochloride…
PQ401
Product Name : PQ401Synonym : Chemical Name : CAS NO.: 196868-63-0Molecular formula : C18H16ClN3O2Molecular Weight: 341.79 g/molClassification : MedChemExpress Products > Research Chemicals > PQ401Description: PQ401 is a collagen gel…
DL-Indole-3-lactic acid
Product Name : DL-Indole-3-lactic acidSynonym : 3-(3-indolyl)-2-hydroxypropionic acidChemical Name : CAS NO.: 1821-52-9Molecular formula : C11H11NO3Molecular Weight: 205.21 g/molClassification : MedChemExpress Products > Research Chemicals > DL-Indole-3-lactic acidDescription: Indole-3-lactic acid…
Diphenylcyclopropenone
Product Name : DiphenylcyclopropenoneSynonym : 2,3-Diphenyl-2-cyclopropen-1-oneChemical Name : CAS NO.: 886-38-4Molecular formula : C15H10OMolecular Weight: 206.24 g/molClassification : MedChemExpress Products > Research Chemicals > Building Blocks > Cycloalkanes and Cycloalkenes…
TAPI-1
Product Name : TAPI-1Synonym : Chemical Name : CAS NO.: 163847-77-6Molecular formula : C26H37N5O5Molecular Weight: 499.60 g/molClassification : MedChemExpress Products > Life Sciences > TAPI-1Description: TAPI-1 is a protease inhibitor…
(2S)-1-[(2S,3R)-2-Amino-3-hydroxybutanoyl]pyrrolidine-2-carboxylic acid
Product Name : (2S)-1-pyrrolidine-2-carboxylic acidSynonym : Chemical Name : CAS NO.: 46398-79-2Molecular formula : C9H16N2O4Molecular Weight: 216.23 g/molClassification : MedChemExpress Products > Research Chemicals >Fine Chemicals > (2S)-1-pyrrolidine-2-carboxylic acidDescription: (2S)-1-pyrrolidine-2-carboxylic…
Fmoc-hydrazide
Product Name : Fmoc-hydrazideSynonym : Chemical Name : CAS NO.: 35661-51-9Molecular formula : C15H14N2O2Molecular Weight: 254.28 g/molClassification : MedChemExpress Products > Research Chemicals > Fmoc-hydrazideDescription: Fmoc-hydrazide is a chemical compound…
Grazoprevir hydrate
Product Name : Grazoprevir hydrateSynonym : Chemical Name : CAS NO.: 1350462-55-3Molecular formula : C38H52N6O10SMolecular Weight: 784.9 g/molClassification : MedChemExpress Products > Antimicrobials > Grazoprevir hydrateDescription: Grazoprevir is a drug…
Cefoxitin sodium
Product Name : Cefoxitin sodiumSynonym : (6R,7S)-3-methyl]-7-methoxy-8-oxo-7--5-thia-1-azabicyclooct-2-ene-2-carboxylic A cid Sodium SaltChemical Name : CAS NO.: 33564-30-6Molecular formula : C16H16N3NaO7S2Molecular Weight: 449.44 g/molClassification : MedChemExpress Products > Antimicrobials > Antibiotics >…
Benzyldodecyldimethylammonium Chloride Dihydrate
Product Name : Benzyldodecyldimethylammonium Chloride DihydrateSynonym : Chemical Name : CAS NO.: 147228-80-6Molecular formula : C21H38ClN·2H2OMolecular Weight: 376.02 g/molClassification : MedChemExpress Products > Research Chemicals > Benzyldodecyldimethylammonium Chloride DihydrateDescription: Benzyldodecyldimethylammonium…
Cariprazine
Product Name : CariprazineSynonym : N’-ethyl]cyclohexyl]-N,N-dimethylureaChemical Name : CAS NO.: 839712-12-8Molecular formula : C21H32Cl2N4OMolecular Weight: 427.41 g/molClassification : MedChemExpress Products > Life Sciences > Ligands > Dopamine Receptors > CariprazineDescription:…
(2S)-1-(7-Ethylfuro[2,3-G]indazol-1-yl)propan-2-amine
Product Name : (2S)-1-(7-Ethylfuroindazol-1-yl)propan-2-amineSynonym : Chemical Name : CAS NO.: 372163-84-3Molecular formula : C14H17N3OMolecular Weight: 243.3 g/molClassification : MedChemExpress Products > Life Sciences > Ligands > (2S)-1-(7-Ethylfuroindazol-1-yl)propan-2-amineDescription: (2S)-1-(7-Ethylfuroindazol-1-yl)propan-2-amine is a…
Z-LLY-FMK
Product Name : Z-LLY-FMKSynonym : Chemical Name : CAS NO.: 133410-84-1Molecular formula : C30H40FN3O6Molecular Weight: 557.65 g/molClassification : MedChemExpress Products > Life Sciences > Z-LLY-FMKDescription: Z-LLY-FMK is a pro-apoptotic protein…
Cyclo(Arg-Gly-Asp-D-Phe-Val)
Product Name : Cyclo(Arg-Gly-Asp-D-Phe-Val)Synonym : Chemical Name : CAS NO.: 137813-35-5Molecular formula : C26H38N8O7 • CH3COOH • 2H2OMolecular Weight: 670.91 g/molClassification : MedChemExpress Products > Life Sciences > Cyclo(Arg-Gly-Asp-D-Phe-Val)Description: Cyclo(Arg-Gly-Asp-D-Phe-Val)…
Tri-guluronic acid sodium salt
Product Name : Tri-guluronic acid sodium saltSynonym : Chemical Name : CAS NO.: 66754-14-1Molecular formula : C18H23O19Na3Molecular Weight: 612.33 g/molClassification : MedChemExpress Products > Carbohydrates > Oligosaccharides > Tri-guluronic acid…
Physcion-1-O-²-D-glucoside
Product Name : Physcion-1-O-²-D-glucosideSynonym : Chemical Name : CAS NO.: 26296-54-8Molecular formula : C22H22O10Molecular Weight: 446.41 g/molClassification : MedChemExpress Products > Life Sciences > Physcion-1-O-²-D-glucosideDescription: Physcion-1-O-²-D-glucoside is a natural product…
Acid-PEG4-sulfone-PEG4-acid
Product Name : Acid-PEG4-sulfone-PEG4-acidSynonym : Chemical Name : CAS NO.: 2055024-37-6Molecular formula : C22H42O14SMolecular Weight: 562.6 g/molClassification : MedChemExpress Products > Research Chemicals > Acid-PEG4-sulfone-PEG4-acidDescription: Acid-PEG4-sulfone-PEG4-acid is a heterobifunctional PEG…
Cefixime trihydrate
Product Name : Cefixime trihydrateSynonym : (6R,7R)-7-acetyl]amino]-3-ethenyl-8-oxo-5-thia-1-azabicyclooct-2-ene- 2-carboxylic acidFK-027FR- 17027Chemical Name : CAS NO.: 125110-14-7Molecular formula : C16H15N5O7S2Molecular Weight: 453.45 g/molClassification : MedChemExpress Products > Antimicrobials > Antibiotics > Cefixime…
Thienopyridone
Product Name : ThienopyridoneSynonym : Chemical Name : CAS NO.: 1018454-97-1Molecular formula : C7H5NOSMolecular Weight: 151.19 g/molClassification : MedChemExpress Products > Research Chemicals > ThienopyridoneDescription: Thienopyridone is a drug that…
5-O-Methylgenistein
Product Name : 5-O-MethylgenisteinSynonym : Chemical Name : CAS NO.: 4569-98-6Molecular formula : C16H12O5Molecular Weight: 284.26 g/molClassification : MedChemExpress Products > Natural Products > 5-O-MethylgenisteinDescription: 5-o-Methylgenistein is a natural compound…
BAY 850
Product Name : BAY 850Synonym : Chemical Name : CAS NO.: 2099142-76-2Molecular formula : C38H44ClN5O3Molecular Weight: 654.24 g/molClassification : MedChemExpress Products > Life Sciences > BAY 850Description: BAY 850 is…
Extracellular Death Factor trifluoroacetate salt
Product Name : Extracellular Death Factor trifluoroacetate saltSynonym : H-Asn-Asn-Trp-Asn-Asn-OH H-NNWNN-OHChemical Name : CAS NO.: 960129-66-2Molecular formula : C27H36N10O10Molecular Weight: 660.64 g/molClassification : MedChemExpress Products > Research Chemicals > Extracellular…
MeOSuc-Ala-Phe-Lys-AMC trifluoroacetate salt
Product Name : MeOSuc-Ala-Phe-Lys-AMC trifluoroacetate saltSynonym : Chemical Name : CAS NO.: 201853-92-1Molecular formula : C33H41N5O8•C2HF3O2Molecular Weight: 749.73 g/molClassification : MedChemExpress Products > Life Sciences > Peptides and Biochemicals >…
2-Hydroxy oleic acid
Product Name : 2-Hydroxy oleic acidSynonym : (9Z)-2-Hydroxy-9-octadecenoic acid(Z)-2-Hydroxyoctadec-9-enoic acid2-Hydroxyoleic acidChemical Name : CAS NO.: 56472-29-8Molecular formula : C18H34O3Molecular Weight: 298.46 g/molClassification : MedChemExpress Products > Research Chemicals > 2-Hydroxy…
2-Octadecyl-1H-indole-5-carboxylic acid
Product Name : 2-Octadecyl-1H-indole-5-carboxylic acidSynonym : Chemical Name : CAS NO.: 81364-78-5Molecular formula : C27H43NO2Molecular Weight: 413.6 g/molClassification : MedChemExpress Products > Life Sciences > 2-Octadecyl-1H-indole-5-carboxylic acidDescription: 2-Octadecyl-1H-indole-5-carboxylic acid is…
(2S)-2-Aminopentanediamide
Product Name : (2S)-2-AminopentanediamideSynonym : Chemical Name : CAS NO.: 2013-17-4Molecular formula : C5H11N3O2Molecular Weight: 145.16 g/molClassification : MedChemExpress Products > Research Chemicals > (2S)-2-AminopentanediamideDescription: (2S)-2-Aminopentanediamide is a metabolite that…
N-Cbz-glycine 4-nitrophenyl ester
Product Name : N-Cbz-glycine 4-nitrophenyl esterSynonym : Chemical Name : CAS NO.: 1738-86-9Molecular formula : C16H14N2O6Molecular Weight: 330.29 g/molClassification : MedChemExpress Products > Research Chemicals > N-Cbz-glycine 4-nitrophenyl esterDescription: N-Cbz-glycine…
4H-Thieno[3,2-b]pyrrole-5-carboxylic acid
Product Name : 4H-Thienopyrrole-5-carboxylic acidSynonym : Chemical Name : CAS NO.: 39793-31-2Molecular formula : C7H5NO2SMolecular Weight: 167.19 g/molClassification : MedChemExpress Products > Research Chemicals > 4H-Thienopyrrole-5-carboxylic acidDescription: 4H-Thienopyrrole-5-carboxylic acid (TCA)…
Olprinone
Product Name : OlprinoneSynonym : Chemical Name : CAS NO.: 106730-54-5Molecular formula : C14H10N4OMolecular Weight: 250.26 g/molClassification : MedChemExpress Products > Life Sciences > OlprinoneDescription: Olprinone is a drug that…
Indole-3-acetyl-L-isoleucine
Product Name : Indole-3-acetyl-L-isoleucineSynonym : N-(3-Indolylacetyl)-L-isoleucineChemical Name : CAS NO.: 57105-45-0Molecular formula : C16H20N2O3Molecular Weight: 288.34 g/molClassification : MedChemExpress Products > Research Chemicals > Indole-3-acetyl-L-isoleucineDescription: Indole-3-acetyl-L-isoleucine (IAIL) is a conjugate…
Naringin dihydrochalcone
Product Name : Naringin dihydrochalconeSynonym : 1-oxy]-2,6-dihydroxyphenyl]-3-(4-hydroxyphenyl)-1-propanoneChemical Name : CAS NO.: 18916-17-1Molecular formula : C27H34O14Molecular Weight: 582.55 g/molClassification : MedChemExpress Products > Natural Products > Glycated Natural Products from Higher…
Oleoyl-L-a-lysophosphatidic acid sodium salt – Bio-X ™
Product Name : Oleoyl-L-a-lysophosphatidic acid sodium salt - Bio-X ™Synonym : 1-O-9Z-Octadecenoyl-sn-glyceryl-3-phosphoric acidChemical Name : CAS NO.: 22556-62-3Molecular formula : C21H40NaO7PMolecular Weight: 458.5 g/molClassification : MedChemExpress Products > Life Sciences…
Osteocalcin (1-49) (human) acetate salt
Product Name : Osteocalcin (1-49) (human) acetate saltSynonym : Chemical Name : CAS NO.: 136461-80-8Molecular formula : C269H381N67O82S2Molecular Weight: 5,929.44 g/molClassification : MedChemExpress Products > Research Chemicals > Osteocalcin (1-49)…
Methylthymol blue sodium
Product Name : Methylthymol blue sodiumSynonym : Chemical Name : CAS NO.: 1945-77-3Molecular formula : C37H40N2Na4O13SMolecular Weight: 844.74 g/molClassification : MedChemExpress Products > Research Chemicals > Methylthymol blue sodiumDescription: Methylthymol…
2-(3,4-Dihydroxybenzoyl)-3-(4-hydroxy-3-iodo-5-methoxyphenyl)prop-2-enenitrile
Product Name : 2-(3,4-Dihydroxybenzoyl)-3-(4-hydroxy-3-iodo-5-methoxyphenyl)prop-2-enenitrileSynonym : Chemical Name : CAS NO.: 1094048-77-7Molecular formula : C17H12INO5Molecular Weight: 437.18 g/molClassification : MedChemExpress Products > Life Sciences > 2-(3,4-Dihydroxybenzoyl)-3-(4-hydroxy-3-iodo-5-methoxyphenyl)prop-2-enenitrileDescription: 2-(3,4-Dihydroxybenzoyl)-3-(4-hydroxy-3-iodo-5-methoxyphenyl)prop-2-enenitrile is a high purity…
Racotumomab
Product Name : RacotumomabSynonym : Chemical Name : CAS NO.: 946832-34-4Molecular formula : Molecular Weight: Classification : MedChemExpress Products > Life Sciences > Antibodies > Monoclonal Antibodies > RacotumomabDescription: Anti-NGNA…
4,5-Dihydro-1-(2-hydroxyethyl)-8-[[5-(4-methyl-1-piperazinyl)-2-(trifluoromethoxy)phenyl]amino]-1H-pyrazolo[4,3-h]quinazoline-3-carb oxamide
Product Name : 4,5-Dihydro-1-(2-hydroxyethyl)-8-amino]-1H-pyrazoloquinazoline-3-carb oxamideSynonym : Chemical Name : CAS NO.: 1034616-18-6Molecular formula : C24H27F3N8O3Molecular Weight: 532.52 g/molClassification : MedChemExpress Products > Research Chemicals > 4,5-Dihydro-1-(2-hydroxyethyl)-8-amino]-1H-pyrazoloquinazoline-3-carb oxamideDescription: 4,5-Dihydro-1-(2-hydroxyethyl)-8-amino]-1H-pyrazoloquinazoline-3-carb oxamide is…
Darusentan
Product Name : DarusentanSynonym : Chemical Name : CAS NO.: 171714-84-4Molecular formula : C22H22N2O6Molecular Weight: 410.42 g/molClassification : MedChemExpress Products > Research Chemicals > DarusentanDescription: Darusentan is a drug that…
Sodium 3-nitrobenzoate, 94%, may contain up to ca 10% water
Product Name : Sodium 3-nitrobenzoate, 94%, may contain up to ca 10% waterSynonym: IUPAC Name : sodium 3-nitrobenzoateCAS NO.Irinotecan :827-95-2Molecular Weight : Molecular formula: C7H4NNaO4Smiles: .Dantrolene C(=O)C1=CC=CC(=C1)()=ODescription: Sodium 3-nitrobenzoate is…
5-Methoxy-2-mercaptobenzimidazole, 99+%
Product Name : 5-Methoxy-2-mercaptobenzimidazole, 99+%Synonym: IUPAC Name : 5-methoxy-2,3-dihydro-1H-1,3-benzodiazole-2-thioneCAS NO.Pirtobrutinib :37052-78-1Molecular Weight : Molecular formula: C8H8N2OSSmiles: COC1=CC=C2NC(=S)NC2=C1Description: IL-1 beta Protein, Mouse PMID:24635174
Diethyl (2-oxopropyl)phosphonate, 96%
Product Name : Diethyl (2-oxopropyl)phosphonate, 96%Synonym: IUPAC Name : diethyl (2-oxopropyl)phosphonateCAS NO.:1067-71-6Molecular Weight : Molecular formula: C7H15O4PSmiles: CCOP(=O)(CC(C)=O)OCCDescription: CF53 Isocarboxazid PMID:23376608
4-(2-Methylphenoxy)piperidine, 97%
Product Name : 4-(2-Methylphenoxy)piperidine, 97%Synonym: IUPAC Name : CAS NO.:Molecular Weight : Molecular formula: Smiles: Description: Birtamimab Ampicillin PMID:24761411
2-Bromothiophene, 98%
Product Name : 2-Bromothiophene, 98%Synonym: IUPAC Name : 2-bromothiopheneCAS NO.:1003-09-4Molecular Weight : Molecular formula: C4H3BrSSmiles: BrC1=CC=CS1Description: BET bromodomain inhibitor Aprepitant PMID:23715856 MedChemExpress (MCE) offers a wide range of high-quality research…
Thiamphenicol
Product Name : ThiamphenicolSynonym: IUPAC Name : 2,2-dichloro-N-acetamideCAS NO.:15318-45-3Molecular Weight : Molecular formula: C12H15Cl2NO5SSmiles: CS(=O)(=O)C1=CC=C(C=C1)(O)(CO)NC(=O)C(Cl)ClDescription: Thiamphenicol is used to treat chancroid in men and uncomplicated gonorrhea. It is used in…
Germanium, plasma standard solution, Specpure™ Ge 1000μg/mL
Product Name : Germanium, plasma standard solution, Specpure™ Ge 1000μg/mLSynonym: IUPAC Name : CAS NO.Megestrol acetate :Molecular Weight : Molecular formula: Smiles: Description: TL13-68 PMID:25016614 MedChemExpress (MCE) offers a wide…
Metazachlor
Product Name : MetazachlorSynonym : 2-Chloro-N-(2,6-dimethylphenyl)-N-(1H-pyrazol-1-ylmethyl)acetamideButisanButisan 400SCChemical Name : CAS NO.: 67129-08-2Molecular formula : C14H16ClN3OMolecular Weight: 277.75 g/molClassification : MedChemExpress Products > Research Chemicals > MetazachlorDescription: Metazachlor is a chemical…
R115866
Product Name : R115866Synonym : Chemical Name : CAS NO.: 870093-23-5Molecular formula : C21H23N5SMolecular Weight: 377.51 g/molClassification : MedChemExpress Products > Research Chemicals > R115866Description: R115866 is a new growth…
tert-butyl N-{2-[(2-aminoethyl)disulfanyl]ethyl}carbamate
Product Name : tert-butyl N-{2-ethyl}carbamateSynonym : Chemical Name : CAS NO.: 485800-26-8Molecular formula : C9H20N2O2S2Molecular Weight: 252.4 g/molClassification : MedChemExpress Products > Research Chemicals > tert-butyl N-{2-ethyl}carbamateDescription: Tert-Butyl N-{2-ethyl}carbamate (TBEC)…
Acetanilide, 98%
Product Name : Acetanilide, 98%Synonym: IUPAC Name : N-phenylacetamideCAS NO.:103-84-4Molecular Weight : Molecular formula: C8H9NOSmiles: CC(=O)NC1=CC=CC=C1Description: Acetanilide is used as an intermediate in the synthesis of rubber accelerator, dyes and…
3′,5′-Dimethylacetophenone, 97%
Product Name : 3',5'-Dimethylacetophenone, 97%Synonym: IUPAC Name : CAS NO.LM10 :Molecular Weight : Molecular formula: Smiles: Description: Brepocitinib PMID:24463635
Platinum crucible with reinforced rim, Top Dia 62mm, Bot Dia37mm, Ht 68mm, Base Thickness 0.48mm, Capacity 150mL
Product Name : Platinum crucible with reinforced rim, Top Dia 62mm, Bot Dia37mm, Ht 68mm, Base Thickness 0.48mm, Capacity 150mLSynonym: IUPAC Name : CAS NO.Crystal Violet :Molecular Weight : Molecular…
2,5-Bis(5-tert-butyl-2-benzoxazolyl)thiophene, 99%
Product Name : 2,5-Bis(5-tert-butyl-2-benzoxazolyl)thiophene, 99%Synonym: IUPAC Name : 5-tert-butyl-2--1,3-benzoxazoleCAS NO.:7128-64-5Molecular Weight : Molecular formula: C26H26N2O2SSmiles: CC(C)(C)C1=CC=C2OC(=NC2=C1)C1=CC=C(S1)C1=NC2=CC(=CC=C2O1)C(C)(C)CDescription: 2,5-Bis(5-tert-butyl-2-benzoxazolyl)thiophene is used as an optical brightener which converts UV light into visible light.Streptozocin…
Lead wire, 2.0mm (0.08in) dia, Puratronic™, 99.99+% (metals basis)
Product Name : Lead wire, 2.0mm (0.08in) dia, Puratronic™, 99.99+% (metals basis)Synonym: IUPAC Name : leadCAS NO.:7439-92-1Molecular Weight : Molecular formula: PbSmiles: Description: Lumasiran Luminol PMID:24633055 MedChemExpress (MCE) offers a…
1,1,2,2-Tetrabromoethane, 98%
Product Name : 1,1,2,2-Tetrabromoethane, 98%Synonym: IUPAC Name : 1,1,2,2-tetrabromoethaneCAS NO.Edoxaban :79-27-6Molecular Weight : Molecular formula: C2H2Br4Smiles: BrC(Br)C(Br)BrDescription: Prednisone PMID:24202965 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and…
Thymidine
Product Name : ThymidineSynonym : 2'-Deoxy-3,4-dihydrothymidine 1-(2-Deoxy-beta-D-ribofuranosyl)-5-methyluracil 1-(2-Deoxy-beta-D-ribofuranosyl)thymineChemical Name : CAS NO.: 50-89-5Molecular formula : C10H14N2O5Molecular Weight: 242.23 g/molClassification : MedChemExpress Products > Nucleosides > Nucleosides, Nucleotides and Nucleic acids…
11β-Hydroxycedrelone
Product Name : 11β-HydroxycedreloneSynonym : Chemical Name : CAS NO.: 283174-18-5Molecular formula : C26H30O6Molecular Weight: 438.5 g/molClassification : MedChemExpress Products > Natural Products > 11β-HydroxycedreloneDescription: 11β-Hydroxycedrelone is a potent cytotoxic…
ARL 67156 trisodium hydrate
Product Name : ARL 67156 trisodium hydrateSynonym : FPL 671566-N,N-Diethyl-b-g-dibromomethylene-D-adenosine-5?-triphosphate trisodium salt hydrateChemical Name : CAS NO.: 1021868-83-6Molecular formula : C15H21Br2N5O12P3·3Na·xH2OMolecular Weight: Classification : MedChemExpress Products > Life Sciences >…
(R)-(-)-alpha-Methoxyphenylacetic acid, 99%
Product Name : (R)-(-)-alpha-Methoxyphenylacetic acid, 99%Synonym: IUPAC Name : (2R)-2-methoxy-2-phenylacetateCAS NO.:3966-32-3Molecular Weight : Molecular formula: C9H9O3Smiles: CO(C()=O)C1=CC=CC=C1Description: Formaldehyde dehydrogenase Ifosfamide PMID:23710097
Stainless Steel wire, 0.25mm (0.01in) dia, annealed, Type 304
Product Name : Stainless Steel wire, 0.25mm (0.01in) dia, annealed, Type 304Synonym: IUPAC Name : CAS NO.:Molecular Weight : Molecular formula: Smiles: Description: Stainless Steel Wire are suitable for making…
5-Azacytidine, 98%
Product Name : 5-Azacytidine, 98%Synonym: IUPAC Name : 4-amino-1--1,2-dihydro-1,3,5-triazin-2-oneCAS NO.:320-67-2Molecular Weight : Molecular formula: C8H12N4O5Smiles: NC1=NC(=O)N(C=N1)1O(CO)(O)1ODescription: 5-Azacytidine, its incorporation into RNA alters RNA synthesis and processing, and results in inhibition…
Cesium carbonate, 99.99%, (trace metal basis)
Product Name : Cesium carbonate, 99.99%, (trace metal basis)Synonym: IUPAC Name : dicaesium(1+) carbonateCAS NO.:534-17-8Molecular Weight : Molecular formula: CCs2O3Smiles: .GLP-1 receptor agonist 1 .Amlodipine C()=ODescription: PMID:23773119
p-Tolylacetylene, 98%
Product Name : p-Tolylacetylene, 98%Synonym: IUPAC Name : 1-ethynyl-4-methylbenzeneCAS NO.Eprenetapopt :766-97-2Molecular Weight : Molecular formula: C9H8Smiles: CC1=CC=C(C=C1)C#CDescription: 4-Ethynyltoluene was used in the synthesis of bis(bicyclic) products by the cycloaddition of…
4-Methylmorpholine N-oxide, 50% w/w aq. soln.
Product Name : 4-Methylmorpholine N-oxide, 50% w/w aq. soln.Synonym: IUPAC Name : 4-methylmorpholin-4-ium-4-olateCAS NO.Trilexium :7529-22-8Molecular Weight : Molecular formula: C5H11NO2Smiles: C1()CCOCC1Description: 4-Methylmorpholine N-oxide acts as a non-metallic catalyst for the…
Desmethylangolensin
Product Name : DesmethylangolensinSynonym : 1-(2,4-Dihydroxyphenyl)-2-(4-Hydroxyphenyl)propan-1-oneChemical Name : CAS NO.: 21255-69-6Molecular formula : C15H14O4Molecular Weight: 258.27 g/molClassification : MedChemExpress Products > Natural Products > DesmethylangolensinDescription: Desmethylangolensin is a natural product…
3-Amino-1,2,4-triazole
Product Name : 3-Amino-1,2,4-triazoleSynonym : 1H-1,2,4-Triazol-5-amine, Amitrole3-Amino-s-triazole(4H-1,2,4-Triazol-3-yl)amineChemical Name : CAS NO.: 61-82-5Molecular formula : C2H4N4Molecular Weight: 84.08 g/molClassification : MedChemExpress Products > Research Chemicals >Fine Chemicals > 3-Amino-1,2,4-triazoleDescription: Inhibitor of…
Jatrorrhizine
Product Name : JatrorrhizineSynonym : Chemical Name : CAS NO.: 3621-38-3Molecular formula : C20H20NO4Molecular Weight: 338.38 g/molClassification : MedChemExpress Products > Natural Products > Alkaloids > JatrorrhizineDescription: Jatrorrhizine is a…
2-Chloro-4-iodoaniline, 98%
Product Name : 2-Chloro-4-iodoaniline, 98%Synonym: IUPAC Name : 2-chloro-4-iodoanilineCAS NO.Imatinib Mesylate :42016-93-3Molecular Weight : Molecular formula: C6H5ClINSmiles: NC1=CC=C(I)C=C1ClDescription: Pyridostigmine bromide PMID:24189672
n-Pentane, anhydrous, 99.8+%, over molecular sieves, packaged under Argon in resealable ChemSeal™ bottles
Product Name : n-Pentane, anhydrous, 99.8+%, over molecular sieves, packaged under Argon in resealable ChemSeal™ bottlesSynonym: IUPAC Name : pentaneCAS NO.:109-66-0Molecular Weight : Molecular formula: C5H12Smiles: CCCCCDescription: n-Pentane is used…
Dichlorodiphenylsilane, 97%
Product Name : Dichlorodiphenylsilane, 97%Synonym: IUPAC Name : dichlorodiphenylsilaneCAS NO.Tiragolumab :80-10-4Molecular Weight : Molecular formula: C12H10Cl2SiSmiles: Cl(Cl)(C1=CC=CC=C1)C1=CC=CC=C1Description: Hesperetin PMID:24078122
trans-Dibromobis(triphenylphosphine)palladium(II), Pd 13.4%
Product Name : trans-Dibromobis(triphenylphosphine)palladium(II), Pd 13.4%Synonym: IUPAC Name : palladium(2+) bis(triphenylphosphane) dibromideCAS NO.:22180-53-6Molecular Weight : Molecular formula: C36H30Br2P2PdSmiles: .Selexipag .Streptozocin .PMID:23341580 C1=CC=C(C=C1)P(C1=CC=CC=C1)C1=CC=CC=C1.C1=CC=C(C=C1)P(C1=CC=CC=C1)C1=CC=CC=C1Description: Hydrogenation
4-tert-Butylcyclohexanone, 99%
Product Name : 4-tert-Butylcyclohexanone, 99%Synonym: IUPAC Name : 4-tert-butylcyclohexan-1-oneCAS NO.:98-53-3Molecular Weight : Molecular formula: C10H18OSmiles: CC(C)(C)C1CCC(=O)CC1Description: Sulfamethoxazole β-Amyloid (1-40) (TFA) PMID:23443926 MedChemExpress (MCE) offers a wide range of high-quality research…
1-Bromoundecane, 98%
Product Name : 1-Bromoundecane, 98%Synonym: IUPAC Name : 1-bromoundecaneCAS NO.:693-67-4Molecular Weight : Molecular formula: C11H23BrSmiles: CCCCCCCCCCCBrDescription: Atorvastatin Inclisiran sodium PMID:35850484 MedChemExpress (MCE) offers a wide range of high-quality research chemicals…
SB 4
Product Name : SB 4Synonym : Chemical Name : CAS NO.: 100874-08-6Molecular formula : C14H10BrNOSMolecular Weight: 320.2 g/molClassification : MedChemExpress Products > Life Sciences > SB 4Description: SB 4 is…
Procarbazine
Product Name : ProcarbazineSynonym : Chemical Name : CAS NO.: 671-16-9Molecular formula : C12H19N3OMolecular Weight: 221.3 g/molClassification : MedChemExpress Products > Research Chemicals > ProcarbazineDescription: Alkylating agent; immunosuppressive agentPurity :…
ML 349
Product Name : ML 349Synonym : Chemical Name : CAS NO.: 890819-86-0Molecular formula : C23H22N2O4S2Molecular Weight: 454.56 g/molClassification : MedChemExpress Products > Controlled Products > ML 349Description: ML 349 is…
Betaine, 98%, for analysis, anhydrous
Product Name : Betaine, 98%, for analysis, anhydrousSynonym: IUPAC Name : 2-(trimethylazaniumyl)acetateCAS NO.Nile Red :107-43-7Molecular Weight : Molecular formula: C5H11NO2Smiles: C(C)(C)CC()=ODescription: Remogliflozin etabonate PMID:23983589
Sodium metaperiodate, 98%
Product Name : Sodium metaperiodate, 98%Synonym: IUPAC Name : sodium periodateCAS NO.:7790-28-5Molecular Weight : Molecular formula: INaO4Smiles: .(=O)(=O)=ODescription: Source of periodic acid, as an analytical reagent, and as an oxidizing…
Ethyl p-toluenesulfonate, 98%
Product Name : Ethyl p-toluenesulfonate, 98%Synonym: IUPAC Name : ethyl 4-methylbenzene-1-sulfonateCAS NO.:80-40-0Molecular Weight : Molecular formula: C9H12O3SSmiles: CCOS(=O)(=O)C1=CC=C(C)C=C1Description: Ethyl p-toluenesulfonate was used to develop an extraction method for methyl and…
Zirconium silicate
Product Name : Zirconium silicateSynonym: IUPAC Name : zirconium(4+) silicateCAS NO.:10101-52-7Molecular Weight : Molecular formula: O4SiZrSmiles: .()()Description: Zirconium silicate is used for manufacturing refractory materials for applications where resistance to…
L-(+)-Valinol, 97%
Product Name : L-(+)-Valinol, 97%Synonym: IUPAC Name : (2S)-2-amino-3-methylbutan-1-olCAS NO.:2026-48-4Molecular Weight : Molecular formula: C5H13NOSmiles: CC(C)(N)CODescription: L-(+)-Valinol reacts with aldehydes and nitriles to form imines and oxazolines, respectively, for asymmetric…
Methyl 2-fluorobenzoate, 98%
Product Name : Methyl 2-fluorobenzoate, 98%Synonym: IUPAC Name : methyl 2-fluorobenzoateCAS NO.Liraglutide :394-35-4Molecular Weight : Molecular formula: C8H7FO2Smiles: COC(=O)C1=CC=CC=C1FDescription: Eugenol PMID:23912708 MedChemExpress (MCE) offers a wide range of high-quality research…
Tetrafluoroboric acid, ca 50% w/w aq. soln.
Product Name : Tetrafluoroboric acid, ca 50% w/w aq. soln.Synonym: IUPAC Name : hydrogen tetrafluoroboranuideCAS NO.:16872-11-0Molecular Weight : Molecular formula: BF4HSmiles: .Tisotumab F(F)(F)FDescription: Tetrafluoroboric acid is used in conjunction with…
NCI172112
Product Name : NCI172112Synonym : Chemical Name : CAS NO.: 56605-16-4Molecular formula : C14H23Cl2N3O2Molecular Weight: 336.3 g/molClassification : MedChemExpress Products > Life Sciences > NCI172112Description: NCI172112 is a human immunoglobulin…
Secoisolariciresinol hydrochloride
Product Name : Secoisolariciresinol hydrochlorideSynonym : Chemical Name : CAS NO.: 158932-33-3Molecular formula : C32H46O16Molecular Weight: 686.7 g/molClassification : MedChemExpress Products > Natural Products > Secoisolariciresinol hydrochlorideDescription: Secoisolariciresinol is a…
Demethylvestitol
Product Name : DemethylvestitolSynonym : Chemical Name : CAS NO.: 65332-45-8Molecular formula : C15H14O4Molecular Weight: 258.27 g/molClassification : MedChemExpress Products > Natural Products > DemethylvestitolDescription: Demethylvestitol is a naturally occurring…
2-Nitro-2-methyl-1,3-propanediol, 99%
Product Name : 2-Nitro-2-methyl-1,3-propanediol, 99%Synonym: IUPAC Name : CAS NO.Cilostazol :77-49-6Molecular Weight : Molecular formula: Smiles: Description: 5-Aminolevulinic acid hydrochloride PMID:23329650
Cyclohexane, 99+%, pure
Product Name : Cyclohexane, 99+%, pureSynonym: IUPAC Name : cyclohexaneCAS NO.Abexinostat :110-82-7Molecular Weight : Molecular formula: C6H12Smiles: C1CCCCC1Description: Ryanodine PMID:23558135
1-Bromotetradecane, 98%
Product Name : 1-Bromotetradecane, 98%Synonym: IUPAC Name : 1-bromotetradecaneCAS NO.Vilazodone :112-71-0Molecular Weight : Molecular formula: C14H29BrSmiles: CCCCCCCCCCCCCCBrDescription: Voriconazole PMID:24025603
3-Iodophenylacetic acid, 98%
Product Name : 3-Iodophenylacetic acid, 98%Synonym: IUPAC Name : 2-(3-iodophenyl)acetic acidCAS NO.:1878-69-9Molecular Weight : Molecular formula: C8H7IO2Smiles: OC(=O)CC1=CC(I)=CC=C1Description: Calcein-AM Semaglutide PMID:23460641 MedChemExpress (MCE) offers a wide range of high-quality research…
2-Amino-5-fluorobenzothiazole, 98%
Product Name : 2-Amino-5-fluorobenzothiazole, 98%Synonym: IUPAC Name : CAS NO.:Molecular Weight : Molecular formula: Smiles: Description: 2-Amino-5-fluorobenzothiazole is used as organic chemical synthesis intermediate.AD80 Cytarabine PMID:24120168 MedChemExpress (MCE) offers a…
PU 23
Product Name : PU 23Synonym : Chemical Name : CAS NO.: 817635-93-1Molecular formula : C21H19N3O3S2Molecular Weight: 425.5 g/molClassification : MedChemExpress Products > Life Sciences > PU 23Description: PU 23 is…
Scabertopin
Product Name : ScabertopinSynonym : Chemical Name : CAS NO.: 185213-52-9Molecular formula : C20H22O6Molecular Weight: 358.39 g/molClassification : MedChemExpress Products > Natural Products > ScabertopinDescription: Scabertopin is a compound that…
Ro 4987655
Product Name : Ro 4987655Synonym : 3,4-Difluoro-2--N-(2-hydroxyethoxy)-5-oxazinan-2-yl)methyl]benzamideRo4987655CH 4987655Chemical Name : CAS NO.: 874101-00-5Molecular formula : C20H19F3IN3O5Molecular Weight: 565.28 g/molClassification : MedChemExpress Products > Life Sciences > Ro 4987655Description: MEK inhibitorPurity…
Bis(tri-o-tolylphosphine)palladium(0), Pd 14.9%
Product Name : Bis(tri-o-tolylphosphine)palladium(0), Pd 14.9%Synonym: IUPAC Name : bis(tris(2-methylphenyl)phosphane) palladiumCAS NO.:69861-71-8Molecular Weight : Molecular formula: C42H42P2PdSmiles: .Micrococcal nuclease CC1=CC=CC=C1P(C1=CC=CC=C1C)C1=CC=CC=C1C.CC1=CC=CC=C1P(C1=CC=CC=C1C)C1=CC=CC=C1CDescription: Bis(tri-o-tolylphosphine)palladium(0) is used as a catalyst for palladium-catalyzed cross-coupling reactions,…
Indium rod, 2.38mm (0.094in) dia, 99.99% (metals basis)
Product Name : Indium rod, 2.38mm (0.094in) dia, 99.99% (metals basis)Synonym: IUPAC Name : CAS NO.Tenapanor :Molecular Weight : Molecular formula: Smiles: Description: Mycophenolate Mofetil PMID:23453497
Poly(vinyl acetate), ∽ M.W. 170,000
Product Name : Poly(vinyl acetate), ∽ M.W. 170,000Synonym: IUPAC Name : CAS NO.:9003-20-7Molecular Weight : Molecular formula: (C4H6O2)nSmiles: CC(=O)OC(-*)C-*Description: Aloe emodin ML115 PMID:23329319
N,N’-Bis(salicylidene)ethylenediaminecobalt(II), 96%
Product Name : N,N'-Bis(salicylidene)ethylenediaminecobalt(II), 96%Synonym: IUPAC Name : CAS NO.:14167-18-1Molecular Weight : Molecular formula: Smiles: Description: Salcomine catalyzes the oxidation of 2,6-disubstituted phenols by dioxygen.Brexpiprazole Experimental inhibitor of human cytμloviris…
Cadmium iodide, 99.5% (metals basis)
Product Name : Cadmium iodide, 99.5% (metals basis)Synonym: IUPAC Name : cadmium(2+) diiodideCAS NO.:7790-80-9Molecular Weight : Molecular formula: CdI2Smiles: .Telmisartan .iBRD4-BD1 Description: It is used in lithography, photography, electroplating, as…
Ruthenium(III) chloride, 99.9%, (trace metal basis), anhydrous
Product Name : Ruthenium(III) chloride, 99.9%, (trace metal basis), anhydrousSynonym: IUPAC Name : ruthenium(3+) trichlorideCAS NO.:10049-08-8Molecular Weight : Molecular formula: Cl3RuSmiles: .Tylosin .Irbesartan .PMID:25046520 Description: MedChemExpress (MCE) offers a wide…
Zoxamide
Product Name : ZoxamideSynonym : 3,5-Dichloro-N-(3-chloro-1-ethyl-1-methyl-2-oxopropyl)-4-methylbenzamideRH 7281ZoxiumChemical Name : CAS NO.: 156052-68-5Molecular formula : C14H16Cl3NO2Molecular Weight: 336.64 g/molClassification : MedChemExpress Products > Research Chemicals > ZoxamideDescription: Zoxamide is a chemical…
Hedragonic acid
Product Name : Hedragonic acidSynonym : Simiarenol methylthiomethyl etherChemical Name : CAS NO.: 466-02-4Molecular formula : C32H54OSMolecular Weight: 486.84 g/molClassification : MedChemExpress Products > Controlled Products > Hedragonic acidDescription: Hedragonic…
Estradiol cypionate
Product Name : Estradiol cypionateSynonym : Chemical Name : CAS NO.: 313-06-4Molecular formula : C26H36O3Molecular Weight: 396.56 g/molClassification : MedChemExpress Products > Research Chemicals > Estradiol cypionateDescription: Estradiol cypionate is…
Cyclododecanol, 98+%
Product Name : Cyclododecanol, 98+%Synonym: IUPAC Name : cyclododecanolCAS NO.Dp44mT :1724-39-6Molecular Weight : Molecular formula: C12H24OSmiles: OC1CCCCCCCCCCC1Description: Lactate PMID:23600560
Methyl Violet 2B
Product Name : Methyl Violet 2BSynonym: IUPAC Name : bismethyliumCAS NO.L-Asparaginase :8004-87-3Molecular Weight : Molecular formula: C24H28N3Smiles: CNC1=CC=C(C=C1)(C1=CC=C(C=C1)N(C)C)C1=CC=C(C=C1)N(C)CDescription: AZ505 ditrifluoroacetate PMID:23664186
Diosgenin
Product Name : DiosgeninSynonym: IUPAC Name : CAS NO.:Molecular Weight : Molecular formula: Smiles: Description: Diosgenin is the precursor for the semisynthesis of progesterone which in turn was used in…
4-Bromophenylzinc iodide, 0.5M in THF, packaged under Argon in resealable ChemSeal™ bottles
Product Name : 4-Bromophenylzinc iodide, 0.5M in THF, packaged under Argon in resealable ChemSeal™ bottlesSynonym: IUPAC Name : CAS NO.Phenytoin :Molecular Weight : Molecular formula: Smiles: Description: Miridesap PMID:23865629
Benzyl 4-bromophenyl ketone
Product Name : Benzyl 4-bromophenyl ketoneSynonym: IUPAC Name : 1-(4-bromophenyl)-2-phenylethan-1-oneCAS NO.Pentostatin :2001-29-8Molecular Weight : Molecular formula: C14H11BrOSmiles: BrC1=CC=C(C=C1)C(=O)CC1=CC=CC=C1Description: Prednisolone disodium phosphate PMID:23907051 MedChemExpress (MCE) offers a wide range of high-quality…
Poly(vinylidene fluoride)
Product Name : Poly(vinylidene fluoride)Synonym: IUPAC Name : CAS NO.:24937-79-9Molecular Weight : Molecular formula: (C2H2F2)nSmiles: FC(F)(-*)C-*Description: Poly(vinylidene fluoride) is useful in coatings, film, filter cloth, instrument linings, filtration membranes, pump…
Trimethyl borate, 99%
Product Name : Trimethyl borate, 99%Synonym: IUPAC Name : trimethyl borateCAS NO.:121-43-7Molecular Weight : Molecular formula: C3H9BO3Smiles: COB(OC)OCDescription: Trimethyl borate is a useful reagent in organic synthesis.Brepocitinib It is involved…
1,2,3,7-tetramethoxyxanthone
Product Name : 1,2,3,7-tetramethoxyxanthoneSynonym : Chemical Name : CAS NO.: 22804-52-0Molecular formula : C17H16O6Molecular Weight: 316.31 g/molClassification : MedChemExpress Products > Research Chemicals > 1,2,3,7-tetramethoxyxanthoneDescription: 1,2,3,7-Tetramethoxyxanthone is a natural product…
GS 9973
Product Name : GS 9973Synonym : 6-(1H-Indazol-6-yl)-N-(4-morpholinophenyl)imidazopyrazin-8-amineChemical Name : CAS NO.: 1229208-44-9Molecular formula : C23H21N7OMolecular Weight: 411.47 g/molClassification : MedChemExpress Products > Life Sciences > GS 9973Description: GS 9973 is…
Branebrutinib (BMS-986195)
Product Name : Branebrutinib (BMS-986195)Synonym : Chemical Name : CAS NO.: 1912445-55-6Molecular formula : C20H23FN4O2Molecular Weight: 370.42 g/molClassification : MedChemExpress Products > Life Sciences > Branebrutinib (BMS-986195)Description: Branebrutinib is a…
Tetrakis(dimethylamino)germanium(IV), 99% (metals basis)
Product Name : Tetrakis(dimethylamino)germanium(IV), 99% (metals basis)Synonym: IUPAC Name : CAS NO.:Molecular Weight : Molecular formula: Smiles: Description: Preparation of nitridesCemiplimab Picaridin PMID:25558565
N-Acetyl-DL-serine, 98+%
Product Name : N-Acetyl-DL-serine, 98+%Synonym: IUPAC Name : 2-acetamido-3-hydroxypropanoic acidCAS NO.:97-14-3Molecular Weight : Molecular formula: C5H9NO4Smiles: CC(=O)NC(CO)C(O)=ODescription: Finerenone Losmapimod PMID:35954127
3-Fluorophthalic anhydride, 98%
Product Name : 3-Fluorophthalic anhydride, 98%Synonym: IUPAC Name : 4-fluoro-1,3-dihydro-2-benzofuran-1,3-dioneCAS NO.Saxagliptin :652-39-1Molecular Weight : Molecular formula: C8H3FO3Smiles: FC1=CC=CC2=C1C(=O)OC2=ODescription: Olutasidenib PMID:24238102
Creatine phosphate disodium salt tetrahydrate, 99%
Product Name : Creatine phosphate disodium salt tetrahydrate, 99%Synonym: IUPAC Name : disodium tetrahydrate ({aminomethylidene}amino)phosphonateCAS NO.:71519-72-7Molecular Weight : Molecular formula: C4H16N3Na2O9PSmiles: O.Girentuximab O.Punicalagin O.PMID:23600560 O...CN(CC(O)=O)C(N)=NP()()=ODescription:
2-Nitrobenzaldehyde, 99+%
Product Name : 2-Nitrobenzaldehyde, 99+%Synonym: IUPAC Name : 2-nitrobenzaldehydeCAS NO.:552-89-6Molecular Weight : Molecular formula: C7H5NO3Smiles: (=O)C1=CC=CC=C1C=ODescription: Casirivimab Anti-Mouse LAG-3 Antibody PMID:31085260 MedChemExpress (MCE) offers a wide range of high-quality research…
Dimethyl 2,6-pyridinedicarboxylate, 99%
Product Name : Dimethyl 2,6-pyridinedicarboxylate, 99%Synonym: IUPAC Name : 2,6-dimethyl pyridine-2,6-dicarboxylateCAS NO.DM3 :5453-67-8Molecular Weight : Molecular formula: C9H9NO4Smiles: COC(=O)C1=CC=CC(=N1)C(=O)OCDescription: Tixagevimab PMID:25016614 MedChemExpress (MCE) offers a wide range of high-quality research…
N-Boc-L-proline methyl ester, 96%
Product Name : N-Boc-L-proline methyl ester, 96%Synonym: IUPAC Name : CAS NO.:59936-29-7Molecular Weight : Molecular formula: Smiles: Description: N-Boc-L-proline methyl ester is generally used as a intermediate in pharmaceutical and…
Bekm 1
Product Name : Bekm 1Synonym : Chemical Name : CAS NO.: 524962-01-4Molecular formula : C174H261N51O52S6Molecular Weight: 4,092 g/molClassification : MedChemExpress Products > Life Sciences > Ligands > Bekm 1Description: Bekm…
Delta-Valerolactone
Product Name : Delta-ValerolactoneSynonym : Tetrahydro-2H-pyran-2-oneChemical Name : CAS NO.: 542-28-9Molecular formula : C5H8O2Molecular Weight: 100.12 g/molClassification : MedChemExpress Products > Research Chemicals > Delta-ValerolactoneDescription: Delta-Valerolactone is a sodium salt…
1,1,1-Trifluoroethyl-PEG4-aminooxy
Product Name : 1,1,1-Trifluoroethyl-PEG4-aminooxySynonym : Chemical Name : CAS NO.: 1895922-78-7Molecular formula : C10H20F3NO5Molecular Weight: 291.26 g/molClassification : MedChemExpress Products > Research Chemicals > 1,1,1-Trifluoroethyl-PEG4-aminooxyDescription: 1,1,1-Trifluoroethyl-PEG4-aminooxy is a PEG linker…
2,4,4-Trimethyl-2-pentene, 98%
Product Name : 2,4,4-Trimethyl-2-pentene, 98%Synonym: IUPAC Name : 2,4,4-trimethylpent-2-eneCAS NO.TAT peptide :107-40-4Molecular Weight : Molecular formula: C8H16Smiles: CC(C)=CC(C)(C)CDescription: Ifosfamide PMID:23935843
1-Ethyl-3-methylimidazolium methyl sulfate, 98%
Product Name : 1-Ethyl-3-methylimidazolium methyl sulfate, 98%Synonym: IUPAC Name : 1-ethyl-3-methyl-1H-imidazol-3-ium methyl sulfateCAS NO.:516474-01-4Molecular Weight : Molecular formula: C7H14N2O4SSmiles: COS()(=O)=O.Rhodamine B CCN1C=C(C)=C1Description: Phorbol 12-myristate 13-acetate PMID:23539298
2,3-Dibromobutane, (+/-) + meso, 98+%
Product Name : 2,3-Dibromobutane, (+/-) + meso, 98+%Synonym: IUPAC Name : 2,3-dibromobutaneCAS NO.Oxacillin sodium salt :5408-86-6Molecular Weight : Molecular formula: C4H8Br2Smiles: CC(Br)C(C)BrDescription: Dacarbazine PMID:23771862
4-Chloro-2-methylthiopyrimidine, 97%
Product Name : 4-Chloro-2-methylthiopyrimidine, 97%Synonym: IUPAC Name : CAS NO.Salicylic acid :49844-90-8Molecular Weight : Molecular formula: Smiles: Description: PP1 PMID:23892407
Calcium hypochlorite, tech.
Product Name : Calcium hypochlorite, tech.Synonym: IUPAC Name : calcium dihypochloriteCAS NO.:7778-54-3Molecular Weight : Molecular formula: CaCl2O2Smiles: .Cl.Mitapivat ClDescription: Deodorant, oxidizing agent, bleaching agentCalcium hypochlorite is used for swimming pool…
N-Thionylaniline, 96%
Product Name : N-Thionylaniline, 96%Synonym: IUPAC Name : N-(oxo-λ⁴-sulfanylidene)anilineCAS NO.:1122-83-4Molecular Weight : Molecular formula: C6H5NOSSmiles: O=S=NC1=CC=CC=C1Description: It is a versatile synthetic intermediate and an active pharmaceutical intermediate.AB928 Metolazone PMID:26644518 MedChemExpress…
Valrubicin
Product Name : ValrubicinSynonym : Pentanoic acid 2--a-L-lyxo-hexopyranosyl]oxy]-2-naphthacenyl]-2-oxoethyl esterAntibiotic AD 32N-Trifluoroacetyladriamycin 14-vChemical Name : CAS NO.: 56124-62-0Molecular formula : C34H36F3NO13Molecular Weight: 723.64 g/molClassification : MedChemExpress Products > Antimicrobials > Antibiotics…
2′-Hydroxy-5′-methoxyacetophenone
Product Name : 2'-Hydroxy-5'-methoxyacetophenoneSynonym : Chemical Name : CAS NO.: 705-15-7Molecular formula : C9H10O3Molecular Weight: 166.17 g/molClassification : MedChemExpress Products > Research Chemicals > 2'-Hydroxy-5'-methoxyacetophenoneDescription: 2'-Hydroxy-5'-methoxyacetophenone is a molecule that…
MLKL Inhibitor, Necrosulfonamide
Product Name : MLKL Inhibitor, NecrosulfonamideSynonym : Chemical Name : CAS NO.: 432531-71-0Molecular formula : C18H15N5O6S2Molecular Weight: 461.47 g/molClassification : MedChemExpress Products > Life Sciences > MLKL Inhibitor, NecrosulfonamideDescription: Necrosulfonamide…
2-Bromo-3-nitrotoluene, 98%
Product Name : 2-Bromo-3-nitrotoluene, 98%Synonym: IUPAC Name : 2-bromo-1-methyl-3-nitrobenzeneCAS NO.:41085-43-2Molecular Weight : Molecular formula: C7H6BrNO2Smiles: CC1=CC=CC(=C1Br)()=ODescription: Anti-Mouse IL-1a Antibody Terlipressin acetate PMID:33679749
2,3-Dichloroaniline, 99%
Product Name : 2,3-Dichloroaniline, 99%Synonym: IUPAC Name : 2,3-dichloroanilineCAS NO.Ligelizumab :608-27-5Molecular Weight : Molecular formula: C6H5Cl2NSmiles: NC1=CC=CC(Cl)=C1ClDescription: 2,3-Dichloroaniline is used in dyestuffs, pigments and optical brighteners.Bovine Serum Albumin It is…
1,2-Bis(trimethylsilyloxy)ethane, 98%
Product Name : 1,2-Bis(trimethylsilyloxy)ethane, 98%Synonym: IUPAC Name : CAS NO.:7381-30-8Molecular Weight : Molecular formula: Smiles: Description: Galanthamine Ostarine PMID:23618405
N-Methylcyclohexylamine, 98%
Product Name : N-Methylcyclohexylamine, 98%Synonym: IUPAC Name : N-methylcyclohexanamineCAS NO.Glibenclamide :100-60-7Molecular Weight : Molecular formula: C7H15NSmiles: CNC1CCCCC1Description: SKI II PMID:24220671
2,6-Dichloropurine, 97%
Product Name : 2,6-Dichloropurine, 97%Synonym: IUPAC Name : CAS NO.Astemizole :5451-40-1Molecular Weight : Molecular formula: Smiles: Description: Mirvetuximab PMID:23319057 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and…
Barium, plasma standard solution, Specpure™ Ba 10μg/mL
Product Name : Barium, plasma standard solution, Specpure™ Ba 10μg/mLSynonym: IUPAC Name : CAS NO.NPB :Molecular Weight : Molecular formula: Smiles: Description: Telitacicept PMID:24268253 MedChemExpress (MCE) offers a wide range…
(RS)-PPg
Product Name : (RS)-PPgSynonym : Chemical Name : CAS NO.: 120667-15-4Molecular formula : Molecular Weight: Classification : MedChemExpress Products > Research Chemicals > (RS)-PPgDescription: The extracellular domain of the protein…
Leptomycin B
Product Name : Leptomycin BSynonym : Chemical Name : CAS NO.: 87081-35-4Molecular formula : Molecular Weight: Classification : MedChemExpress Products > Antimicrobials > Antibiotics > Leptomycin BDescription: Leptomycin B is…
Przewaquinone A
Product Name : Przewaquinone ASynonym : Chemical Name : CAS NO.: 76843-23-7Molecular formula : C19H18O4Molecular Weight: 310.34 g/molClassification : MedChemExpress Products > Research Chemicals > Przewaquinone ADescription: Przewaquinone A is…
2,3-Dibromobutyric acid, 97%
Product Name : 2,3-Dibromobutyric acid, 97%Synonym: IUPAC Name : 2,3-dibromobutanoic acidCAS NO.Letermovir :600-30-6Molecular Weight : Molecular formula: C4H6Br2O2Smiles: CC(Br)C(Br)C(O)=ODescription: (±)-Clopidogrel (bisulfate) PMID:24624203
1-(2-Tetrahydropyranyl)-3-(trifluoromethyl)-1H-pyrazole-5-boronic acid, 95%
Product Name : 1-(2-Tetrahydropyranyl)-3-(trifluoromethyl)-1H-pyrazole-5-boronic acid, 95%Synonym: IUPAC Name : boronic acidCAS NO.:1141878-45-6Molecular Weight : Molecular formula: C9H12BF3N2O3Smiles: OB(O)C1=CC(=NN1C1CCCCO1)C(F)(F)FDescription: Lurbinectedin Kanamycins (sulfate) PMID:25429455
Potassium carbonate sesquihydrate, ACS, 98.5-101.0%
Product Name : Potassium carbonate sesquihydrate, ACS, 98.5-101.0%Synonym: IUPAC Name : tetrapotassium trihydrate dicarbonateCAS NO.Catumaxomab :6381-79-9Molecular Weight : Molecular formula: C2H6K4O9Smiles: O.O.O.....C()=O.C()=ODescription: Potassium carbonate sesquihydrate is used for manufacturing of…
2-Amino-5-nitrobenzoic acid, 98%
Product Name : 2-Amino-5-nitrobenzoic acid, 98%Synonym: IUPAC Name : CAS NO.:616-79-5Molecular Weight : Molecular formula: Smiles: Description: 2-Amino-5-nitrobenzoic acid, is used as an intermediate for dyes and pharmaceuticals.Bethanechol chloride PDGF-BB…
Cadmium sulfate hydrate, 98%
Product Name : Cadmium sulfate hydrate, 98%Synonym: IUPAC Name : cadmium(2+) sulfateCAS NO.:15244-35-6Molecular Weight : Molecular formula: CdO4SSmiles: .Enoxaparin S()(=O)=ODescription: Cadmium sulfate hydrate is used for formulating screens or for…
1,3-Dibromobutane, 98%
Product Name : 1,3-Dibromobutane, 98%Synonym: IUPAC Name : 1,3-dibromobutaneCAS NO.:107-80-2Molecular Weight : Molecular formula: C4H8Br2Smiles: CC(Br)CCBrDescription: Oclacitinib Matuzumab PMID:36628218 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and…
Triethyl phosphate, 98+%
Product Name : Triethyl phosphate, 98+%Synonym: IUPAC Name : triethyl phosphateCAS NO.:78-40-0Molecular Weight : Molecular formula: C6H15O4PSmiles: CCOP(=O)(OCC)OCCDescription: Triethyl phosphate finds it major applications in plastics industry as a flame…
5’-O-DMT-N2-isobutyryl-2’-O-propargylguanosine
Product Name : 5’-O-DMT-N2-isobutyryl-2’-O-propargylguanosineSynonym : Chemical Name : CAS NO.: 171486-53-6Molecular formula : Molecular Weight: Classification : MedChemExpress Products > Nucleosides > 5’-O-DMT-N2-isobutyryl-2’-O-propargylguanosineDescription: 5’-O-DMT-N2-isobutyryl-2’-O-propargylguanosine is an antiviral, anticancer, and nucleoside…
Thioredoxin reductase from escherichia coli
Product Name : Thioredoxin reductase from escherichia coliSynonym : Chemical Name : CAS NO.: 9074-14-0Molecular formula : Molecular Weight: Classification : MedChemExpress Products > Enzymes > Thioredoxin reductase from escherichia…
Lobelanidine
Product Name : LobelanidineSynonym : Chemical Name : CAS NO.: 579-21-5Molecular formula : C22H25NO2Molecular Weight: 335.4 g/molClassification : MedChemExpress Products > Natural Products > LobelanidineDescription: Lobelanidine is a potent anticancer…
Cyclopentanecarboxylic Acid, 98+%
Product Name : Cyclopentanecarboxylic Acid, 98+%Synonym: IUPAC Name : cyclopentanecarboxylic acidCAS NO.:3400-45-1Molecular Weight : Molecular formula: C6H10O2Smiles: OC(=O)C1CCCC1Description: Vilazodone Hydrochloride Dihexa PMID:23812309
4-Methoxystyrene, 96%, stabilized
Product Name : 4-Methoxystyrene, 96%, stabilizedSynonym: IUPAC Name : CAS NO.:637-69-4Molecular Weight : Molecular formula: Smiles: Description: Voxilaprevir Vorinostat PMID:24563649
N-Boc-aniline, 97%
Product Name : N-Boc-aniline, 97%Synonym: IUPAC Name : tert-butyl N-phenylcarbamateCAS NO.:3422-01-3Molecular Weight : Molecular formula: C11H15NO2Smiles: CC(C)(C)OC(=O)NC1=CC=CC=C1Description: Abraxane Epirubicin hydrochloride PMID:34816786
Calcium 2,4-pentanedionate hydrate, 99%
Product Name : Calcium 2,4-pentanedionate hydrate, 99%Synonym: IUPAC Name : calcium bis((2Z)-4-oxopent-2-en-2-olate)CAS NO.:345909-31-1Molecular Weight : Molecular formula: C10H14CaO4Smiles: .Phenacetin C\C()=C\C(C)=O.Ergothioneine C\C()=C\C(C)=ODescription: PMID:24013184
Hexa-n-butylditin, 98%, ACROS Organics™
Product Name : Hexa-n-butylditin, 98%, ACROS Organics™Synonym: IUPAC Name : hexabutyldistannaneCAS NO.Glatiramer acetate :813-19-4Molecular Weight : Molecular formula: C24H54Sn2Smiles: CCCC(CCCC)(CCCC)(CCCC)(CCCC)CCCCDescription: Selexipag PMID:23618405 MedChemExpress (MCE) offers a wide range of high-quality…
alpha-Naphthoflavone, 97%
Product Name : alpha-Naphthoflavone, 97%Synonym: IUPAC Name : 2-phenyl-4H-benzochromen-4-oneCAS NO.SNPB :604-59-1Molecular Weight : Molecular formula: C19H12O2Smiles: O=C1C=C(OC2=C1C=CC1=CC=CC=C21)C1=CC=CC=C1Description: An aryl hydrocarbon receptor antagonistAnti-Mouse IL-10 Antibody PMID:23789847 MedChemExpress (MCE) offers a wide…
Tantalum pellet, 1mm (0.04in) dia x 2mm (0.08in), 99.9% (metals basis)
Product Name : Tantalum pellet, 1mm (0.04in) dia x 2mm (0.08in), 99.9% (metals basis)Synonym: IUPAC Name : tantalumCAS NO.Amikacin sulfate :7440-25-7Molecular Weight : Molecular formula: TaSmiles: Description: Degarelix PMID:23865629 MedChemExpress…
rac 5-Hydroxymethyl Tolterodine by HPLC
Product Name : rac 5-Hydroxymethyl Tolterodine by HPLCSynonym : Chemical Name : CAS NO.: 200801-70-3Molecular formula : C22H31NO2Molecular Weight: 341.49 g/molClassification : MedChemExpress Products > Research Chemicals > rac 5-Hydroxymethyl…
Lenvatinib base
Product Name : Lenvatinib baseSynonym : 4--7-methoxy-quinoline-6-carboxamideChemical Name : CAS NO.: 417716-92-8Molecular formula : C21H19ClN4O4Molecular Weight: 426.85 g/molClassification : MedChemExpress Products > Research Chemicals > Lenvatinib baseDescription: VEGFR2 and VEGFR3…
Vicenin-2
Product Name : Vicenin-2Synonym : Chemical Name : CAS NO.: 23666-13-9Molecular formula : C27H30O15Molecular Weight: 594.52 g/molClassification : MedChemExpress Products > Natural Products > Flavonoids > Vicenin-2Description: Vicenin-2 is a…
Molybdenum slug, 6.35mm (0.25 in.) dia. x 12.7mm (0.50 in.) length, 99.95% (metals basis)
Product Name : Molybdenum slug, 6.35mm (0.25 in.) dia. x 12.7mm (0.50 in.) length, 99.95% (metals basis)Synonym: IUPAC Name : molybdenumCAS NO.:7439-98-7Molecular Weight : Molecular formula: MoSmiles: Description: Ruxolitinib Cetuximab…
8-Aminooctanoic acid, 99%
Product Name : 8-Aminooctanoic acid, 99%Synonym: IUPAC Name : 8-aminooctanoic acidCAS NO.Vibegron :1002-57-9Molecular Weight : Molecular formula: C8H17NO2Smiles: NCCCCCCCC(O)=ODescription: 8-Aminooctanoic acid is involved in the preparation of lactams using enzyme…
Ammonium fluoride, 96%
Product Name : Ammonium fluoride, 96%Synonym: IUPAC Name : ammonium hydrogen difluorideCAS NO.:12125-01-8Molecular Weight : Molecular formula: F2H5NSmiles: .Patritumab ..Description: Ammonium fluoride is used for etching of glass, preservation of…
2-Bromobutane, 98%
Product Name : 2-Bromobutane, 98%Synonym: IUPAC Name : 2-bromobutaneCAS NO.:78-76-2Molecular Weight : Molecular formula: C4H9BrSmiles: CCC(C)BrDescription: 2-Bromobutane is utilized in the synthesis of non-nucleosides.TAT peptide It is used as a…
α-Methyl-D-mannopyranoside, 99+%
Product Name : α-Methyl-D-mannopyranoside, 99+%Synonym: IUPAC Name : 2-(hydroxymethyl)-6-methoxyoxane-3,4,5-triolCAS NO.SAH :617-04-9Molecular Weight : Molecular formula: C7H14O6Smiles: COC1OC(CO)C(O)C(O)C1ODescription: Ritlecitinib (tosylate) PMID:24257686 MedChemExpress (MCE) offers a wide range of high-quality research chemicals…
4-Hydroxybenzhydrazide, 98%
Product Name : 4-Hydroxybenzhydrazide, 98%Synonym: IUPAC Name : 4-hydroxybenzohydrazideCAS NO.TAT peptide :5351-23-5Molecular Weight : Molecular formula: C7H8N2O2Smiles: NNC(=O)C1=CC=C(O)C=C1Description: Carvedilol PMID:24423657 MedChemExpress (MCE) offers a wide range of high-quality research chemicals…
7-(2-Chloroethyl)theophylline, 97%
Product Name : 7-(2-Chloroethyl)theophylline, 97%Synonym: IUPAC Name : 7-(2-chloroethyl)-1,3-dimethyl-2,3,6,7-tetrahydro-1H-purine-2,6-dioneCAS NO.:5878-61-5Molecular Weight : Molecular formula: C9H11ClN4O2Smiles: CN1C2=C(N(CCCl)C=N2)C(=O)N(C)C1=ODescription: An adenosine receptor antagonistCarboplatin PP58 PMID:25955218 MedChemExpress (MCE) offers a wide range of high-quality…
Kakuol
Product Name : KakuolSynonym : Chemical Name : CAS NO.: 18607-90-4Molecular formula : Molecular Weight: Classification : MedChemExpress Products > Research Chemicals > KakuolDescription: Kakuol is a natural product that…
G-36
Product Name : G-36Synonym : Chemical Name : CAS NO.: 1392487-51-2Molecular formula : C22H22BrNO2Molecular Weight: 412.33 g/molClassification : MedChemExpress Products > Research Chemicals > G-36Description: G-36 is a drug that…
(R)-3-Amino-1-(3-(trifluoromethyl)-5,6-dihydro-[1,2,4]triazolo[4 ,3-α]pyrazin-7(8H)-yl)-4-(2,4,5-trifluorophenyl)butan-1-one phosphate anhydrous
Product Name : (R)-3-Amino-1-(3-(trifluoromethyl)-5,6-dihydro-triazolopyrazin-7(8H)-yl)-4-(2,4,5-trifluorophenyl)butan-1-one phosphate anhydrousSynonym : Sitagliptin phosphate anhydrousChemical Name : CAS NO.: 654671-78-0Molecular formula : C16H15F6N5O•H3O4PMolecular Weight: 505.31 g/molClassification : MedChemExpress Products > Research Chemicals >Fine Chemicals >…
Manganese, Oil based standard solution, Specpure™ Mn 5000μg/g
Product Name : Manganese, Oil based standard solution, Specpure™ Mn 5000μg/gSynonym: IUPAC Name : CAS NO.:Molecular Weight : Molecular formula: Smiles: Description: Upadacitinib Nystatin PMID:24360118
6-Bromo-7-azaindole, 96%
Product Name : 6-Bromo-7-azaindole, 96%Synonym: IUPAC Name : 6-bromo-1H-pyrrolopyridineCAS NO.:143468-13-7Molecular Weight : Molecular formula: C7H5BrN2Smiles: BrC1=CC=C2C=CNC2=N1Description: Vaborbactam Tafamidis meglumine PMID:23829314
1,3-Benzenedimethanol, 98%
Product Name : 1,3-Benzenedimethanol, 98%Synonym: IUPAC Name : methanolCAS NO.:626-18-6Molecular Weight : Molecular formula: C8H10O2Smiles: OCC1=CC(CO)=CC=C1Description: Cholera toxin Anti-Mouse IL-1R Antibody PMID:23789847
Rosin
Product Name : RosinSynonym: IUPAC Name : 1,4a-dimethyl-7-(propan-2-yl)-1,2,3,4,4a,4b,5,6,10,10a-decahydrophenanthrene-1-carboxylic acidCAS NO.:8050-09-7Molecular Weight : Molecular formula: C20H30O2Smiles: CC(C)C1=CC2=CCC3C(C)(CCCC3(C)C(O)=O)C2CC1Description: Rosin is an ingredient in printing inks, photocopying and laser printing paper, varnishes, adhesives (glues), soap, paper sizing, soda, soldering fluxes and sealing wax.PP58 It…
4-Hydroxy-3-(trifluoromethoxy)benzaldehyde, 98+%
Product Name : 4-Hydroxy-3-(trifluoromethoxy)benzaldehyde, 98+%Synonym: IUPAC Name : CAS NO.:53104-95-3Molecular Weight : Molecular formula: Smiles: Description: 4-Hydroxy-3-(trifluoromethoxy)benzaldehyde is a fluorinated compound, which is used for biochemical research.Dihexa Fomepizole PMID:23522542 MedChemExpress…
p-Toluenesulfonyl cyanide, 95%
Product Name : p-Toluenesulfonyl cyanide, 95%Synonym: IUPAC Name : 4-methylbenzene-1-sulfonyl cyanideCAS NO.:19158-51-1Molecular Weight : Molecular formula: C8H7NO2SSmiles: CC1=CC=C(C=C1)S(=O)(=O)C#NDescription: Quinupristin Telithromycin PMID:25818744 MedChemExpress (MCE) offers a wide range of high-quality research…
Copper(I) thiocyanate, 96% min
Product Name : Copper(I) thiocyanate, 96% minSynonym: IUPAC Name : λ¹-copper(1+) cyanosulfanideCAS NO.:1111-67-7Molecular Weight : Molecular formula: CCuNSSmiles: .Emtricitabine C#NDescription: It is used as flame retardant.Sonelokimab It is a good…
Dovitinib Lactate
Product Name : Dovitinib LactateSynonym : Chemical Name : CAS NO.: 915769-50-5Molecular formula : C21H21FN6O·C3H6O3·H2OMolecular Weight: 500.52 g/molClassification : MedChemExpress Products > Life Sciences > Dovitinib LactateDescription: Receptor tyrosine kinase…
[(1S,4S,5R,6R,9R,10R,12R,14R)-4,5,6-Trihydroxy-3,11,11,14-tetramethyl-15-oxo-7-tetracyclo[7.5.1.01,5.010,12]pentadeca-2,7-dienyl]met hyl hexadecanoate
Product Name : pentadeca-2,7-dienyl]met hyl hexadecanoateSynonym : Chemical Name : CAS NO.: 39071-33-5Molecular formula : C36H58O6Molecular Weight: 586.8 g/molClassification : MedChemExpress Products > Natural Products > pentadeca-2,7-dienyl]met hyl hexadecanoateDescription: Sieboldianin…
1-(4-Fluorophenyl)-1,3-dihydro-1-[3-(methylamino)propyl]-5-isobenzofurancarbonitrile hydrochloride
Product Name : 1-(4-Fluorophenyl)-1,3-dihydro-1--5-isobenzofurancarbonitrile hydrochlorideSynonym : Chemical Name : CAS NO.: 97743-99-2Molecular formula : C19H19FN2O•HClMolecular Weight: 346.83 g/molClassification : MedChemExpress Products > Research Chemicals > 1-(4-Fluorophenyl)-1,3-dihydro-1--5-isobenzofurancarbonitrile hydrochlorideDescription: 1-(4-Fluorophenyl)-1,3-dihydro-1--5-isobenzofurancarbonitrile hydrochloride is…
Triisopropylsilane, 98%
Product Name : Triisopropylsilane, 98%Synonym: IUPAC Name : CAS NO.:6485-79-6Molecular Weight : Molecular formula: Smiles: Description: Trimethobenzamide hydrochloride Ivosidenib PMID:35126464
Lead rod, 6.35mm (0.25in) dia, 99.999% (metals basis)
Product Name : Lead rod, 6.35mm (0.25in) dia, 99.999% (metals basis)Synonym: IUPAC Name : leadCAS NO.:7439-92-1Molecular Weight : Molecular formula: PbSmiles: Description: Sacituzumab govitecan Paroxetine hydrochloride PMID:23514335
D-beta-Prolinol, 95%
Product Name : D-beta-Prolinol, 95%Synonym: IUPAC Name : (pyrrolidin-3-yl)methanolCAS NO.:110013-18-8Molecular Weight : Molecular formula: C5H11NOSmiles: OCC1CCNC1Description: It is an intermediate in organic syntheses.Stigmasterol Trimethoprim PMID:34645436
Methyl stearate, 99%
Product Name : Methyl stearate, 99%Synonym: IUPAC Name : methyl octadecanoateCAS NO.:112-61-8Molecular Weight : Molecular formula: C19H38O2Smiles: CCCCCCCCCCCCCCCCCC(=O)OCDescription: Methyl stearate is used as a nonionic surfactant, thereby enhancing the solubility…
Copper(II) oxide, 99.7% (metals basis)
Product Name : Copper(II) oxide, 99.7% (metals basis)Synonym: IUPAC Name : copper(2+) oxidandiideCAS NO.:1317-38-0Molecular Weight : Molecular formula: CuOSmiles: .Description: Copper(II) oxide is used as an adsorbent and absorbent, pigment,…
Phenyl formate, 95%
Product Name : Phenyl formate, 95%Synonym: IUPAC Name : phenyl formateCAS NO.Pioglitazone hydrochloride :1864-94-4Molecular Weight : Molecular formula: C7H6O2Smiles: O=COC1=CC=CC=C1Description: Phenyl formate is widely used in the palladium-catalyzed carbonylation of…
Semagacestat
Product Name : SemagacestatSynonym : LY 450139Chemical Name : CAS NO.: 425386-60-3Molecular formula : C19H27O4N3Molecular Weight: 361.44 g/molClassification : MedChemExpress Products > Life Sciences > Ligands > Enzyme Modulators >…
MDK35833
Product Name : MDK35833Synonym : Chemical Name : CAS NO.: 1016535-83-3Molecular formula : C15H12FNOMolecular Weight: 241.26 g/molClassification : MedChemExpress Products > Life Sciences > MDK35833Description: MDK35833 is a Research Tool…
4,9-Anhydrotetrodotoxin
Product Name : 4,9-AnhydrotetrodotoxinSynonym : Chemical Name : CAS NO.: 13072-89-4Molecular formula : C11H15N3O7Molecular Weight: 301.25 g/molClassification : MedChemExpress Products > Life Sciences > 4,9-AnhydrotetrodotoxinDescription: 4,9-Anhydrotetrodotoxin is a sodium citrate…
Iodoethane, 98%, pure, stabilized with silver
Product Name : Iodoethane, 98%, pure, stabilized with silverSynonym: IUPAC Name : iodoethaneCAS NO.:75-03-6Molecular Weight : Molecular formula: C2H5ISmiles: CCIDescription: Demeclocycline Febuxostat PMID:34235739
ORP test solution, 200-275 mV
Product Name : ORP test solution, 200-275 mVSynonym: IUPAC Name : CAS NO.U0126 :Molecular Weight : Molecular formula: Smiles: Description: Test solution for ORP electrodesSARS-CoV-2 PLpro Protein PMID:25027343
Dicumarol
Product Name : DicumarolSynonym: IUPAC Name : 4-hydroxy-3--2H-chromen-2-oneCAS NO.:66-76-2Molecular Weight : Molecular formula: C19H12O6Smiles: OC1=C(CC2=C(O)C3=CC=CC=C3OC2=O)C(=O)OC2=CC=CC=C12Description: Dicumarol is a natural chemical used as an anticoagulant agents that functions as a vitamin…
Silver flake, 80% <20 micron, 99.9% (metals basis)
Product Name : Silver flake, 80%
3,4,5-Trifluorobenzyl bromide, 97%
Product Name : 3,4,5-Trifluorobenzyl bromide, 97%Synonym: IUPAC Name : CAS NO.:220141-72-0Molecular Weight : Molecular formula: Smiles: Description: Iopamidol Venetoclax PMID:35227773 MedChemExpress (MCE) offers a wide range of high-quality research chemicals…
Hydrazine hydrate, 80% (Hydrazine, 51%)
Product Name : Hydrazine hydrate, 80% (Hydrazine, 51%)Synonym: IUPAC Name : hydrazineCAS NO.:10217-52-4Molecular Weight : Molecular formula: H4N2Smiles: NNDescription: FCCP Okadaic acid PMID:23291014 MedChemExpress (MCE) offers a wide range of…
Luteolin 6,8-di-C-glucoside
Product Name : Luteolin 6,8-di-C-glucosideSynonym : Lucenin-2Chemical Name : CAS NO.: 29428-58-8Molecular formula : C27H30O16Molecular Weight: 610.52 g/molClassification : MedChemExpress Products > Natural Products > Flavonoids > Flavones and Isoflavones…
2′-O-Methyl-p-thiouridynyl-(3′->5′)-2′-deoxyadenosine
Product Name : 2'-O-Methyl-p-thiouridynyl-(3'->5')-2'-deoxyadenosineSynonym : Chemical Name : CAS NO.: 475650-36-3Molecular formula : C20H26N7O10PSMolecular Weight: 587.5 g/molClassification : MedChemExpress Products > Nucleosides > 2'-O-Methyl-p-thiouridynyl-(3'->5')-2'-deoxyadenosineDescription: 2'-O-Methyl-p-thiouridynyl-(3'->5')-2'-deoxyadenosine is an analog of the…
Pentosan polysulfate
Product Name : Pentosan polysulfateSynonym : Chemical Name : CAS NO.: 37300-21-3Molecular formula : C10H18O21S4Molecular Weight: 602.5 g/molClassification : MedChemExpress Products > Antimicrobials > Pentosan polysulfateDescription: Pentosan polysulfate is an…
Ammonium hydrogen carbonate, 99.0%
Product Name : Ammonium hydrogen carbonate, 99.0%Synonym: IUPAC Name : dizinc(2+) diammonium tricarbonateCAS NO.:1066-33-7Molecular Weight : Molecular formula: C3H8N2O9Zn2Smiles: ....C()=O.C()=O.C()=ODescription: In cooling baths, fire extinguishing compounds, baking powder formulations, and…
1-Bromopentane, 99%
Product Name : 1-Bromopentane, 99%Synonym: IUPAC Name : 1-bromopentaneCAS NO.:110-53-2Molecular Weight : Molecular formula: C5H11BrSmiles: CCCCCBrDescription: 1-Bromopentane is used in a multitude of organic synthesis.Ziv-aflibercept It is used in iron-catalyzed…
Molybdenum wire, 0.203mm (0.008in) dia, hard, 99.9%(metals basis)
Product Name : Molybdenum wire, 0.203mm (0.008in) dia, hard, 99.9%(metals basis)Synonym: IUPAC Name : molybdenumCAS NO.:7439-98-7Molecular Weight : Molecular formula: MoSmiles: Description: H3B-8800 Cinacalcet hydrochloride PMID:24282960
Holmium(III) fluoride, anhydrous, REacton™, 99.99% (REO)
Product Name : Holmium(III) fluoride, anhydrous, REacton™, 99.99% (REO)Synonym: IUPAC Name : holmium(3+) trifluorideCAS NO.:13760-78-6Molecular Weight : Molecular formula: F3HoSmiles: .Olaparib .Radotinib .PMID:31085260 Description: Holmium(III) fluoride is used as an…
Diethyl (chloromethyl)phosphonate, 98%
Product Name : Diethyl (chloromethyl)phosphonate, 98%Synonym: IUPAC Name : diethyl (chloromethyl)phosphonateCAS NO.Pivekimab :3167-63-3Molecular Weight : Molecular formula: C5H12ClO3PSmiles: CCOP(=O)(CCl)OCCDescription: tBID PMID:23341580 MedChemExpress (MCE) offers a wide range of high-quality research…
2,3-Dimethoxybenzeneboronic acid, 98%
Product Name : 2,3-Dimethoxybenzeneboronic acid, 98%Synonym: IUPAC Name : (2,3-dimethoxyphenyl)boronic acidCAS NO.E 2012 :40972-86-9Molecular Weight : Molecular formula: C8H11BO4Smiles: COC1=CC=CC(B(O)O)=C1OCDescription: Omeprazole sodium PMID:24670464 MedChemExpress (MCE) offers a wide range of…
3-Cyano-4-iodopyridine, 97%
Product Name : 3-Cyano-4-iodopyridine, 97%Synonym: IUPAC Name : 4-iodopyridine-3-carbonitrileCAS NO.CuATSM :490039-72-0Molecular Weight : Molecular formula: C6H3IN2Smiles: IC1=C(C=NC=C1)C#NDescription: β-Amanitin PMID:24818938 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and…
Fumitremorgin C
Product Name : Fumitremorgin CSynonym : Chemical Name : CAS NO.: 118974-02-0Molecular formula : Molecular Weight: Classification : MedChemExpress Products > Life Sciences > Fumitremorgin CDescription: Inhibitor of BCRP transporter;…
4-[(1R,3R)-3-[[(5-Chloro-2-methoxyphenyl)amino]methyl]-2,2-dimethylcyclopropyl]benzenesulfonamide
Product Name : 4-methyl]-2,2-dimethylcyclopropyl]benzenesulfonamideSynonym : Chemical Name : CAS NO.: 1557240-80-8Molecular formula : C19H23ClN2O3SMolecular Weight: 394.9 g/molClassification : MedChemExpress Products > Life Sciences > 4-methyl]-2,2-dimethylcyclopropyl]benzenesulfonamideDescription: 4-methyl]-2,2-dimethylcyclopropyl]benzenesulfonamide is a peptide that…
Tigecycline hydrochloride
Product Name : Tigecycline hydrochlorideSynonym : Chemical Name : CAS NO.: 197654-04-9Molecular formula : C29H39N5O8·HClMolecular Weight: 622.11 g/molClassification : MedChemExpress Products > Antimicrobials > Antibiotics > Tigecycline hydrochlorideDescription: Inhibitor of…
Glassy carbon splinter powder, 0.4-12 micron, type 1
Product Name : Glassy carbon splinter powder, 0.4-12 micron, type 1Synonym: IUPAC Name : CAS NO.:Molecular Weight : Molecular formula: Smiles: Description: AEE788 Zibotentan PMID:23910527
1-Boc-3-hydroxypiperidine, 97%
Product Name : 1-Boc-3-hydroxypiperidine, 97%Synonym: IUPAC Name : tert-butyl (3R)-3-hydroxypiperidine-1-carboxylateCAS NO.:85275-45-2Molecular Weight : Molecular formula: C10H19NO3Smiles: CC(C)(C)OC(=O)N1CCC(O)C1Description: It is a pharmaceutical intermediate.Bevacizumab Pantoprazole sodium PMID:24377291
2-Amino-5-chlorothiazole hydrochloride, 97%
Product Name : 2-Amino-5-chlorothiazole hydrochloride, 97%Synonym: IUPAC Name : hydrogen 5-chloro-1,3-thiazol-2-amine chlorideCAS NO.:55506-37-1Molecular Weight : Molecular formula: C3H4Cl2N2SSmiles: .Trastuzumab duocarmazine .Domperidone monomaleate NC1=NC=C(Cl)S1Description: 2-Amino-5-chlorothiazole hydrochloride is used as starting reagent…
alpha-Toluenesulfonamide, 98%
Product Name : alpha-Toluenesulfonamide, 98%Synonym: IUPAC Name : phenylmethanesulfonamideCAS NO.:4563-33-1Molecular Weight : Molecular formula: C7H9NO2SSmiles: NS(=O)(=O)CC1=CC=CC=C1Description: Inorganic pyrophosphatase Foralumab PMID:22943596
Selenium(I) chloride, 99%
Product Name : Selenium(I) chloride, 99%Synonym: IUPAC Name : CAS NO.:10025-68-0Molecular Weight : Molecular formula: Smiles: Description: Selenium monochloride is used in electronics, instrumentation and other industrial purposes.Duloxetine hydrochloride It…
Indium ingot, polycrystalline, Puratronic™, 99.9995% (metals basis)
Product Name : Indium ingot, polycrystalline, Puratronic™, 99.9995% (metals basis)Synonym: IUPAC Name : indiumCAS NO.Tigecycline :7440-74-6Molecular Weight : Molecular formula: InSmiles: Description: Pirfenidone PMID:33679749 MedChemExpress (MCE) offers a wide range…
Al-24 Tube, Both ends open, O.D.: 30mm, I.D.: 24mm
Product Name : Al-24 Tube, Both ends open, O.D.: 30mm, I.D.: 24mmSynonym: IUPAC Name : CAS NO.:Molecular Weight : Molecular formula: Smiles: Description: Tegaserod maleate Thermolysin PMID:23800738 MedChemExpress (MCE) offers…
Albendazole sulfone
Product Name : Albendazole sulfoneSynonym : N-carbamic acid methyl esterMethyl carbamateChemical Name : CAS NO.: 75184-71-3Molecular formula : C12H15N3O4SMolecular Weight: 297.33 g/molClassification : MedChemExpress Products > Impurities > iAlbendazole >…
13-Methylberberine chloride
Product Name : 13-Methylberberine chlorideSynonym : Chemical Name : CAS NO.: 54260-72-9Molecular formula : C21H20ClNO4Molecular Weight: 385.84 g/molClassification : MedChemExpress Products > Natural Products > 13-Methylberberine chlorideDescription: 13-Methylberberine chloride is…
Estramustine sodium phosphate
Product Name : Estramustine sodium phosphateSynonym : Chemical Name : CAS NO.: 52205-73-9Molecular formula : C23H32NO6Cl2Na2PMolecular Weight: 566.36 g/molClassification : MedChemExpress Products > Research Chemicals > Estramustine sodium phosphateDescription: Estramustine…
Ethyl L(-)-lactate, 97%
Product Name : Ethyl L(-)-lactate, 97%Synonym: IUPAC Name : ethyl (2S)-2-hydroxypropanoateCAS NO.Carmustine :687-47-8Molecular Weight : Molecular formula: C5H10O3Smiles: CCOC(=O)(C)ODescription: Linoleic acid PMID:23715856
Chromotrope 2R
Product Name : Chromotrope 2RSynonym: IUPAC Name : disodium (3Z)-5-hydroxy-4-oxo-3-(2-phenylhydrazin-1-ylidene)-3,4-dihydronaphthalene-2,7-disulfonateCAS NO.:4197-07-3Molecular Weight : Molecular formula: C16H10N2Na2O8S2Smiles: ..OC1=CC(=CC2=C1C(=O)C(=NNC1=CC=CC=C1)C(=C2)S()(=O)=O)S()(=O)=ODescription: Employed as an indicator for complexometry.Anti-Mouse IFNAR1 Antibody It is also applied as…
Sodium hexafluorophosphate, 98%
Product Name : Sodium hexafluorophosphate, 98%Synonym: IUPAC Name : sodium hexafluoro-λ⁵-phosphanuideCAS NO.:21324-39-0Molecular Weight : Molecular formula: F6NaPSmiles: .F(F)(F)(F)(F)FDescription: Sodium hexafluorophosphate is used as an ion pairing agent for the determination…
7-Hydroxy-4-methylcoumarin, 97%
Product Name : 7-Hydroxy-4-methylcoumarin, 97%Synonym: IUPAC Name : 7-hydroxy-4-methyl-2H-chromen-2-oneCAS NO.Galiximab :90-33-5Molecular Weight : Molecular formula: C10H8O3Smiles: CC1=CC(=O)OC2=CC(O)=CC=C12Description: Lysostaphin PMID:36628218
4′-Fluoro-2-biphenylmethylamine, 97%
Product Name : 4'-Fluoro-2-biphenylmethylamine, 97%Synonym: IUPAC Name : 1-{4'-fluoro--2-yl}methanamineCAS NO.:884504-18-1Molecular Weight : Molecular formula: C13H12FNSmiles: NCC1=CC=CC=C1C1=CC=C(F)C=C1Description: Metformin hydrochloride Honokiol PMID:23996047 MedChemExpress (MCE) offers a wide range of high-quality research chemicals…
N-Benzyloxycarbonyl-L-glutamic acid 5-tert-butyl ester, 97%
Product Name : N-Benzyloxycarbonyl-L-glutamic acid 5-tert-butyl ester, 97%Synonym: IUPAC Name : (2S)-2-{amino}-5-(tert-butoxy)-5-oxopentanoateCAS NO.Octreotide acetate :3886-08-6Molecular Weight : Molecular formula: C17H22NO6Smiles: CC(C)(C)OC(=O)CC(NC(=O)OCC1=CC=CC=C1)C()=ODescription: Naproxen PMID:24518703 MedChemExpress (MCE) offers a wide range of…
Phenylselenenyl bromide, 98%
Product Name : Phenylselenenyl bromide, 98%Synonym: IUPAC Name : (phenylselanyl)bromaneCAS NO.:34837-55-3Molecular Weight : Molecular formula: C6H5BrSeSmiles: BrC1=CC=CC=C1Description: Employed in the synthesis of enones by selenenylation of α-cyano ketones with lithium…
Calmodulin-Dependent Protein Kinase II (290-309)
Product Name : Calmodulin-Dependent Protein Kinase II (290-309)Synonym : H-Leu-Lys-Lys-Phe-Asn-Ala-Arg-Arg-Lys-Leu-Lys-Gly-Ala-Ile-Leu-Thr-Thr-Met-Leu-Ala-OH H-LKKFNARRKLKGAILTTMLA-OHChemical Name : CAS NO.: 115044-69-4Molecular formula : C103H185N31O24SMolecular Weight: 2,273.83 g/molClassification : MedChemExpress Products > Enzymes > Calmodulin-Dependent Protein…
Methoxy-PEPy
Product Name : Methoxy-PEPySynonym : Chemical Name : CAS NO.: 524924-76-3Molecular formula : C13H10N2OMolecular Weight: 210.23 g/molClassification : MedChemExpress Products > Research Chemicals > Methoxy-PEPyDescription: Methoxy-PEPy is a unique compound…
2,5-Dimethyl celecoxib
Product Name : 2,5-Dimethyl celecoxibSynonym : 4-benzenesulfonamideDMCChemical Name : CAS NO.: 457639-26-8Molecular formula : C18H16F3N3O2SMolecular Weight: 395.4 g/molClassification : MedChemExpress Products > Research Chemicals > 2,5-Dimethyl celecoxibDescription: 2,5-Dimethyl celecoxib is…
Puerarin, 98%
Product Name : Puerarin, 98%Synonym: IUPAC Name : 7-hydroxy-3-(4-hydroxyphenyl)-8--4H-chromen-4-oneCAS NO.:3681-99-0Molecular Weight : Molecular formula: C21H20O9Smiles: OC1O((O)(O)1O)C1=C2OC=C(C(=O)C2=CC=C1O)C1=CC=C(O)C=C1Description: Thought to interfere with the synthesis of mycolic acids, an essential fatty acid component…
2-Amino-9-fluorenone, 98%
Product Name : 2-Amino-9-fluorenone, 98%Synonym: IUPAC Name : CAS NO.:Molecular Weight : Molecular formula: Smiles: Description: 2-Amino-9-fluorenone is used as an active pharmaceutical intermediate.Eteplirsen Lopinavir PMID:23865629
Sorafenib tosylate
Product Name : Sorafenib tosylateSynonym: IUPAC Name : 4-carbamoyl}amino)phenoxy]-N-methylpyridine-2-carboxamide; 4-methylbenzene-1-sulfonic acidCAS NO.Amlodipine :475207-59-1Molecular Weight : Molecular formula: C28H24ClF3N4O6SSmiles: CC1=CC=C(C=C1)S(O)(=O)=O.Levomepromazine CNC(=O)C1=CC(OC2=CC=C(NC(=O)NC3=CC=C(Cl)C(=C3)C(F)(F)F)C=C2)=CC=N1Description: PMID:23935843
Germanium(IV) iodide, 99.999% (metals basis)
Product Name : Germanium(IV) iodide, 99.999% (metals basis)Synonym: IUPAC Name : CAS NO.:13450-95-8Molecular Weight : 588.31Molecular formula: GeH8I4Smiles: .Mavacamten I.I.5-Aminolevulinic acid hydrochloride I.PMID:27217159 IDescription: Germanium(IV) iodide is a biochemical for proteomics…
5,5-Diphenylhydantoin, 99%
Product Name : 5,5-Diphenylhydantoin, 99%Synonym: IUPAC Name : 5,5-diphenylimidazolidine-2,4-dioneCAS NO.Empagliflozin :57-41-0Molecular Weight : Molecular formula: C15H12N2O2Smiles: O=C1NC(=O)C(N1)(C1=CC=CC=C1)C1=CC=CC=C1Description: Depatuxizumab PMID:24179643
Strontium chloride, 99.99%, (trace metal basis), anhydrous
Product Name : Strontium chloride, 99.99%, (trace metal basis), anhydrousSynonym: IUPAC Name : strontium(2+) hexahydrate dichlorideCAS NO.:10476-85-4Molecular Weight : Molecular formula: Cl2H12O6SrSmiles: O.Duvelisib O.Ramelteon O.PMID:25269910 O.O.O...Description:
3-(2-Fluorophenyl)-1H-pyrazole, 98%
Product Name : 3-(2-Fluorophenyl)-1H-pyrazole, 98%Synonym: IUPAC Name : 5-(2-fluorophenyl)-1H-pyrazoleCAS NO.:149739-32-2Molecular Weight : Molecular formula: C9H7FN2Smiles: FC1=CC=CC=C1C1=CC=NN1Description: Atracurium besylate Vortioxetine PMID:35954127
4-(Trifluoromethyl)cyclohexanone, 97%
Product Name : 4-(Trifluoromethyl)cyclohexanone, 97%Synonym: IUPAC Name : 4-(trifluoromethyl)cyclohexan-1-oneCAS NO.Busulfan :75091-99-5Molecular Weight : Molecular formula: C7H9F3OSmiles: FC(F)(F)C1CCC(=O)CC1Description: Verapamil hydrochloride PMID:24293312
Obinutuzumab – Buffer solution
Product Name : Obinutuzumab - Buffer solutionSynonym : AfutuzumabGA 101Anti-CD20 antibodyChemical Name : CAS NO.: 949142-50-1Molecular formula : Molecular Weight: Classification : MedChemExpress Products > Life Sciences > Antibodies >…
Zotatifin
Product Name : ZotatifinSynonym : Chemical Name : CAS NO.: 2098191-53-6Molecular formula : C28H29N3O5Molecular Weight: 487.55 g/molClassification : MedChemExpress Products > Life Sciences > ZotatifinDescription: Zotatifin is a selective inhibitor…
Xylitol
Product Name : XylitolSynonym : Chemical Name : CAS NO.: 87-99-0Molecular formula : C5H12O5Molecular Weight: 152.15 g/molClassification : MedChemExpress Products > Carbohydrates > Monosaccharides > XylitolDescription: Xylitol is a sugar…
Dichloromethane, 99.8+%, for analysis, stabilized with amylene
Product Name : Dichloromethane, 99.8+%, for analysis, stabilized with amyleneSynonym: IUPAC Name : dichloromethaneCAS NO.:75-09-2Molecular Weight : Molecular formula: CH2Cl2Smiles: ClCClDescription: Levosimendan Atropine PMID:23773119
2-Hydroxyethyl stearate
Product Name : 2-Hydroxyethyl stearateSynonym: IUPAC Name : CAS NO.:111-60-4Molecular Weight : Molecular formula: Smiles: Description: Streptomycin sulfate Fosinopril sodium PMID:32180353
Methylhydrazine sulfate, 98%
Product Name : Methylhydrazine sulfate, 98%Synonym: IUPAC Name : 2-methylhydrazinium hydrogen sulfateCAS NO.Ethynyl Estradiol :302-15-8Molecular Weight : Molecular formula: CH8N2O4SSmiles: CN.Nociceptin OS()(=O)=ODescription: PMID:25027343
1-O-Acetyl-2,3,5-tri-O-benzoyl-beta-D-ribofuranose, 98%
Product Name : 1-O-Acetyl-2,3,5-tri-O-benzoyl-beta-D-ribofuranose, 98%Synonym: IUPAC Name : methyl benzoateCAS NO.:6974-32-9Molecular Weight : Molecular formula: C28H24O9Smiles: CC(=O)OC1OC(COC(=O)C2=CC=CC=C2)C(OC(=O)C2=CC=CC=C2)C1OC(=O)C1=CC=CC=C1Description: BMS-986278 Mitochondria Isolation Kit for Cultured Cells PMID:24578169
4-Fluoro-3-methylaniline, 97%
Product Name : 4-Fluoro-3-methylaniline, 97%Synonym: IUPAC Name : CAS NO.Abelacimab :452-69-7Molecular Weight : Molecular formula: Smiles: Description: Icatibant PMID:35116795
Zinc-copper couple, Copper content typically ca 1-4%
Product Name : Zinc-copper couple, Copper content typically ca 1-4%Synonym: IUPAC Name : CAS NO.:53801-63-1Molecular Weight : Molecular formula: Smiles: Description: Zinc-copper couple is used in the Simmons-Smith cyclopropanation reaction,…
Chromium powder, -100 mesh, 99% (metals basis)
Product Name : Chromium powder, -100 mesh, 99% (metals basis)Synonym: IUPAC Name : CAS NO.:Molecular Weight : Molecular formula: Smiles: Description: Elotuzumab M-CSF Protein, Human PMID:24982871
Cyclohexene oxide, 98%
Product Name : Cyclohexene oxide, 98%Synonym: IUPAC Name : CAS NO.:286-20-4Molecular Weight : Molecular formula: Smiles: Description: Coumestrol Elbasvir PMID:23805407
Cbz-N-amido-PEG2-acid
Product Name : Cbz-N-amido-PEG2-acidSynonym : Chemical Name : CAS NO.: 1347750-76-8Molecular formula : C15H21NO6Molecular Weight: 311.33 g/molClassification : MedChemExpress Products > Research Chemicals > Cbz-N-amido-PEG2-acidDescription: Cbz-N-amido-PEG2-acid is a PEG linker…
1,7-Bis(4-hydroxyphenyl)-3-hydroxy-1,3-heptadien-5-one
Product Name : 1,7-Bis(4-hydroxyphenyl)-3-hydroxy-1,3-heptadien-5-oneSynonym : Chemical Name : CAS NO.: 207792-17-4Molecular formula : C19H18O4Molecular Weight: 310.3 g/molClassification : MedChemExpress Products > Natural Products > 1,7-Bis(4-hydroxyphenyl)-3-hydroxy-1,3-heptadien-5-oneDescription: Curcumin is a natural product…
Gold(III) chloride trihydrate – 50% Au
Product Name : Gold(III) chloride trihydrate - 50% AuSynonym : Chemical Name : CAS NO.: 16961-25-4Molecular formula : HAuCl4·3H2OMolecular Weight: 393.83 g/molClassification : MedChemExpress Products > Research Chemicals > Gold(III)…
1-Phenylnaphthalene, 97%
Product Name : 1-Phenylnaphthalene, 97%Synonym: IUPAC Name : CAS NO.:605-02-7Molecular Weight : Molecular formula: Smiles: Description: Pioglitazone hydrochloride Tixagevimab PMID:23537004
Cyclopentane, 95%
Product Name : Cyclopentane, 95%Synonym: IUPAC Name : cyclopentaneCAS NO.:287-92-3Molecular Weight : Molecular formula: C5H10Smiles: C1CCCC1Description: Cyclopentane is used as green blowing agent and involved in the production of polyurethane…
Tetraethylene Glycol Monooctyl Ether (C8E4), LC/MS grade
Product Name : Tetraethylene Glycol Monooctyl Ether (C8E4), LC/MS gradeSynonym: IUPAC Name : CAS NO.:19327-39-0Molecular Weight : 306.5Molecular formula: C16H34O5Smiles: Description: Tetraethylene Glycol Monooctyl Ether (C8E4) is a non-ionic surfactant…
O-(endo-5-Norbornene-2,3-dicarboximido)-N,N,N’,N’-tetramethyluronium tetrafluoroborate, 98+%
Product Name : O-(endo-5-Norbornene-2,3-dicarboximido)-N,N,N',N'-tetramethyluronium tetrafluoroborate, 98+%Synonym: IUPAC Name : dec-8-en-4-yl}oxy)methylidene]dimethylazanium; tetrafluoroboranuideCAS NO.:125700-73-4Molecular Weight : Molecular formula: C14H20BF4N3O3Smiles: F(F)(F)F.Cefiderocol CN(C)C(ON1C(=O)C2C3CC(C=C3)C2C1=O)=(C)CDescription: NRG-1 Protein, Human PMID:24834360
3-Amino-3-phenyl-1-propanol, 94%
Product Name : 3-Amino-3-phenyl-1-propanol, 94%Synonym: IUPAC Name : 3-amino-3-phenylpropan-1-olCAS NO.:14593-04-5Molecular Weight : Molecular formula: C9H13NOSmiles: NC(CCO)C1=CC=CC=C1Description: Carmustine 7-Amino-4-methylcoumarin PMID:23695992
PBDB-T-2Cl
Product Name : PBDB-T-2ClSynonym: IUPAC Name : CAS NO.Tusamitamab ravtansine :2239295-71-5Molecular Weight : Molecular formula: Smiles: Description: Penicillin V Potassium PMID:24065671
Biphenyl-4-carboxylic acid, 98%
Product Name : Biphenyl-4-carboxylic acid, 98%Synonym: IUPAC Name : -4-carboxylic acidCAS NO.:92-92-2Molecular Weight : Molecular formula: C13H10O2Smiles: OC(=O)C1=CC=C(C=C1)C1=CC=CC=C1Description: Biphenyl-4-carboxylic acid is employed in the synthesis, characterization of europium, terbium complexes.CPDA…
1,6-Hexanedithiol, 97%
Product Name : 1,6-Hexanedithiol, 97%Synonym: IUPAC Name : hexane-1,6-dithiolCAS NO.:1191-43-1Molecular Weight : Molecular formula: C6H14S2Smiles: SCCCCCCSDescription: 1,6-Hexanedithiol is used in self-assembled monolayers (SAMs).Praziquantel It is used in synthetic rubber and…
N-Methyl-alpha-aminoisobutyric acid hydrochloride
Product Name : N-Methyl-alpha-aminoisobutyric acid hydrochlorideSynonym : N-Me-Aib-OH·HClN-Methyl-a-methylalanine hydrochlorideChemical Name : CAS NO.: 2566-34-9Molecular formula : C5H11NO2Molecular Weight: 117.15 g/molClassification : MedChemExpress Products > Research Chemicals > N-Methyl-alpha-aminoisobutyric acid hydrochlorideDescription:…
Kielcorin
Product Name : KielcorinSynonym : Chemical Name : CAS NO.: 64280-48-4Molecular formula : C24H20O8Molecular Weight: 436.4 g/molClassification : MedChemExpress Products > Natural Products > KielcorinDescription: Kielcorin is a hemostatic agent…
Direct black 38
Product Name : Direct black 38Synonym : Chemical Name : CAS NO.: 1937-37-7Molecular formula : C34H27N9O7S2·2NaMolecular Weight: 783.75 g/molClassification : MedChemExpress Products > Research Chemicals > Direct black 38Description: Direct…
(+)-Dibenzoyl-D-tartaric acid, 98+%
Product Name : (+)-Dibenzoyl-D-tartaric acid, 98+%Synonym: IUPAC Name : (2S,3S)-2,3-bis(benzoyloxy)butanedioic acidCAS NO.:17026-42-5Molecular Weight : Molecular formula: C18H14O8Smiles: OC(=O)(OC(=O)C1=CC=CC=C1)(OC(=O)C1=CC=CC=C1)C(O)=ODescription: Nitro blue tetrazolium chloride Tetrakis(triphenylphosphine)palladium PMID:23829314
Thallium, AAS standard solution, Specpure™ Tl 1000μg/mL
Product Name : Thallium, AAS standard solution, Specpure™ Tl 1000μg/mLSynonym: IUPAC Name : CAS NO.:Molecular Weight : Molecular formula: Smiles: Description: 5-Aminosalicylic Acid Xevinapant PMID:23399686
N-Vinylphthalimide, 99%
Product Name : N-Vinylphthalimide, 99%Synonym: IUPAC Name : CAS NO.Prazosin hydrochloride :3485-84-5Molecular Weight : Molecular formula: Smiles: Description: Trifluridine PMID:24423657
2-Formylthiophene-3-boronic acid, 97%
Product Name : 2-Formylthiophene-3-boronic acid, 97%Synonym: IUPAC Name : (2-formylthiophen-3-yl)boronic acidCAS NO.:4347-31-3Molecular Weight : Molecular formula: C5H5BO3SSmiles: OB(O)C1=C(SC=C1)C=ODescription: Cinacalcet Altretamine PMID:24458656
Acetoin, 96%, may exist as mixture of monomer and dimer
Product Name : Acetoin, 96%, may exist as mixture of monomer and dimerSynonym: IUPAC Name : 2,3,5,6-tetramethyl-1,4-dioxane-2,5-diolCAS NO.:23147-57-1Molecular Weight : Molecular formula: C8H16O4Smiles: CC1OC(C)(O)C(C)OC1(C)ODescription: SPP1 Protein, Human (HEK 293, His)…
4-(7-Chloro-4-quinolinylamino)-2-(diethylaminomethyl)phenol dihydrochloride dihydrate, 98%
Product Name : 4-(7-Chloro-4-quinolinylamino)-2-(diethylaminomethyl)phenol dihydrochloride dihydrate, 98%Synonym: IUPAC Name : CAS NO.:Molecular Weight : Molecular formula: Smiles: Description: An anti-malarial quinoline derivative that acts as an histamine N-methyltransferase inhibitorSurfactin Anti-HA…
Bacitracin zinc
Product Name : Bacitracin zincSynonym : Chemical Name : CAS NO.: 1405-89-6Molecular formula : C66H101N17O16SZnMolecular Weight: 1,486.06 g/molClassification : MedChemExpress Products > Research Chemicals > Bacitracin zincDescription: Bacitracin zinc is…
rac Mono(ethylhexyl) phthalate-d4
Product Name : rac Mono(ethylhexyl) phthalate-d4Synonym : Chemical Name : CAS NO.: 1276197-22-8Molecular formula : C16H18D4O4Molecular Weight: 282.37 g/molClassification : MedChemExpress Products > Research Chemicals > rac Mono(ethylhexyl) phthalate-d4Description: The…
4-Acetyl-N-[5-(diethylsulfamoyl)-2-hydroxyphenyl]-3-ethyl-5-methyl-1H-pyrrole-2-carboxamide
Product Name : 4-Acetyl-N--3-ethyl-5-methyl-1H-pyrrole-2-carboxamideSynonym : Chemical Name : CAS NO.: 1370888-71-3Molecular formula : C20H27N3O5SMolecular Weight: 421.5 g/molClassification : MedChemExpress Products > Research Chemicals > 4-Acetyl-N--3-ethyl-5-methyl-1H-pyrrole-2-carboxamideDescription: 4-Acetyl-N--3-ethyl-5-methyl-1H-pyrrole-2-carboxamide is a ligand that…
Nalidixic acid, 99%
Product Name : Nalidixic acid, 99%Synonym: IUPAC Name : 1-ethyl-7-methyl-4-oxo-1,4-dihydro-1,8-naphthyridine-3-carboxylic acidCAS NO.:389-08-2Molecular Weight : Molecular formula: C12H12N2O3Smiles: CCN1C=C(C(O)=O)C(=O)C2=CC=C(C)N=C12Description: Nalidixic acid is a synthetic 1,8-naphthyridine antimicrobial agent.Menaquinone-7 It is also used…
2,5-Diaminopyridine, 98+%, ACROS Organics™
Product Name : 2,5-Diaminopyridine, 98+%, ACROS Organics™Synonym: IUPAC Name : pyridine-2,5-diamineCAS NO.:4318-76-7Molecular Weight : Molecular formula: C5H7N3Smiles: NC1=CC=C(N)N=C1Description: Temafloxacin Cinacalcet PMID:23522542
1,1-Bis(methylthio)-2-nitroethylene, 99%
Product Name : 1,1-Bis(methylthio)-2-nitroethylene, 99%Synonym: IUPAC Name : 1,1-bis(methylsulfanyl)-2-nitroetheneCAS NO.:13623-94-4Molecular Weight : Molecular formula: C4H7NO2S2Smiles: CSC(SC)=C()=ODescription: Ginkgolide B Vadastuximab PMID:24182988
1,2,3,4-Tetrahydronaphthalene, 97%
Product Name : 1,2,3,4-Tetrahydronaphthalene, 97%Synonym: IUPAC Name : 1,2,3,4-tetrahydronaphthaleneCAS NO.Idelalisib :119-64-2Molecular Weight : Molecular formula: C10H12Smiles: C1CCC2=CC=CC=C2C1Description: 1,2,3,4-Tetrahydronaphthalene, is used as an intermediate for organic synthesis, solvent.Olsalazine It is used…
Potassium perrhenate, 99% (metals basis), Re 64%
Product Name : Potassium perrhenate, 99% (metals basis), Re 64%Synonym: IUPAC Name : potassium rheniumoylolateCAS NO.Anti-Mouse Ly-6G/Ly-6C Antibody :10466-65-6Molecular Weight : Molecular formula: KO4ReSmiles: .Pyrotinib (=O)(=O)=ODescription: A powerful oxidizer.PMID:25955218 Also…
(1-BOC-Piperidin-4-yl)acetic acid, 97%
Product Name : (1-BOC-Piperidin-4-yl)acetic acid, 97%Synonym: IUPAC Name : 2-{1-piperidin-4-yl}acetateCAS NO.Digitoxigenin :157688-46-5Molecular Weight : Molecular formula: C12H20NO4Smiles: CC(C)(C)OC(=O)N1CCC(CC()=O)CC1Description: Cladribine PMID:35954127
Alniditan
Product Name : AlniditanSynonym : Chemical Name : CAS NO.: 152317-89-0Molecular formula : C17H26N4OMolecular Weight: 302.4 g/molClassification : MedChemExpress Products > Life Sciences > AlniditanDescription: Alniditan is a diagnostic agent…
5-(3-(4-Fluorophenyl)-1-phenyl-1H-pyrazol-4-yl)imidazolidine-2,4-dione
Product Name : 5-(3-(4-Fluorophenyl)-1-phenyl-1H-pyrazol-4-yl)imidazolidine-2,4-dioneSynonym : Chemical Name : CAS NO.: 484049-04-9Molecular formula : C18H13FN4O2Molecular Weight: 336.32 g/molClassification : MedChemExpress Products > Research Chemicals > 5-(3-(4-Fluorophenyl)-1-phenyl-1H-pyrazol-4-yl)imidazolidine-2,4-dioneDescription: 5-(3-(4-Fluorophenyl)-1-phenyl-1H-pyrazol-4-yl)imidazolidine-2,4-dione is a compound that…
Nimesulide-d5
Product Name : Nimesulide-d5Synonym : Chemical Name : CAS NO.: 1330180-22-7Molecular formula : C13H7D5N2O5SMolecular Weight: 313.34 g/molClassification : MedChemExpress Products > Life Sciences > Nimesulide-d5Description: Nimesulide-d5 is a 5-fluorinated derivative…
3-Bromobiphenyl, 97%
Product Name : 3-Bromobiphenyl, 97%Synonym: IUPAC Name : 3-bromo-1,1'-biphenylCAS NO.Escitalopram :2113-57-7Molecular Weight : Molecular formula: C12H9BrSmiles: BrC1=CC=CC(=C1)C1=CC=CC=C1Description: Fondaparinux sodium PMID:23537004
3-Tolylboronic acid, 97%
Product Name : 3-Tolylboronic acid, 97%Synonym: IUPAC Name : (3-methylphenyl)boronic acidCAS NO.:17933-03-8Molecular Weight : Molecular formula: C7H9BO2Smiles: CC1=CC=CC(=C1)B(O)ODescription: Miltefosine Clazosentan PMID:23443926
3,4-Dihydro-2H-1,5-benzodioxepin-7-carboxylic acid, 98%
Product Name : 3,4-Dihydro-2H-1,5-benzodioxepin-7-carboxylic acid, 98%Synonym: IUPAC Name : 3,4-dihydro-2H-1,5-benzodioxepine-2-carboxylic acidCAS NO.:33632-74-5Molecular Weight : Molecular formula: C10H10O4Smiles: OC(=O)C1CCOC2=CC=CC=C2O1Description: Tecovirimat Prolgolimab PMID:24883330
4-Fluorophenol, 99%
Product Name : 4-Fluorophenol, 99%Synonym: IUPAC Name : 4-fluorophenolCAS NO.:371-41-5Molecular Weight : Molecular formula: C6H5FOSmiles: OC1=CC=C(F)C=C1Description: 4-Fluorophenol is a fluorinated phenolic compound with various applications as an starting reagent for…
L-Asparagine tert-butyl ester hydrochloride, 95%
Product Name : L-Asparagine tert-butyl ester hydrochloride, 95%Synonym: IUPAC Name : tert-butyl 2-amino-3-carbamoylpropanoate hydrochlorideCAS NO.:63094-81-5Molecular Weight : Molecular formula: C8H17ClN2O3Smiles: Cl.Paxalisib CC(C)(C)OC(=O)C(N)CC(N)=ODescription: NAPQI PMID:23710097
Citric acid, Anhydrous, 99.5 to 100.5% (Dry Basis)
Product Name : Citric acid, Anhydrous, 99.5 to 100.5% (Dry Basis)Synonym: IUPAC Name : 2-hydroxypropane-1,2,3-tricarboxylic acidCAS NO.:77-92-9Molecular Weight : Molecular formula: C6H8O7Smiles: OC(=O)CC(O)(CC(O)=O)C(O)=ODescription: Tetrahydroberberine Rilpivirine PMID:23912708
Butyrophenone, 99%
Product Name : Butyrophenone, 99%Synonym: IUPAC Name : 1-phenylbutan-1-oneCAS NO.OF-1 :495-40-9Molecular Weight : Molecular formula: C10H12OSmiles: CCCC(=O)C1=CC=CC=C1Description: Butyrophenone is used as intermediates of Liquid CrystalsGM-CSF Protein, Mouse PMID:25558565
SNAP 37889
Product Name : SNAP 37889Synonym : 1,3-Dihydro-1-phenyl-3-imino]-2H-indol-2-oneChemical Name : CAS NO.: 303149-14-6Molecular formula : C21H13F3N2OMolecular Weight: 366.34 g/molClassification : MedChemExpress Products > Life Sciences > SNAP 37889Description: Gal3 selective antagonist;…
Racecadotril – Bio-X ™
Product Name : Racecadotril - Bio-X ™Synonym : N-2-(Acetylthio)methyl-1-oxo-3-phenylpropylglycine phenylmethyl esterAcetorphan(+/-)-RacecadotrilChemical Name : CAS NO.: 81110-73-8Molecular formula : C21H23NO4SMolecular Weight: 385.48 g/molClassification : MedChemExpress Products > Life Sciences > Ligands…
Bicozamycin
Product Name : BicozamycinSynonym : AizumycinChemical Name : CAS NO.: 38129-37-2Molecular formula : C12H18N2O7Molecular Weight: 302.28 g/molClassification : MedChemExpress Products > Antimicrobials > Antibiotics > BicozamycinDescription: Bicozamycin is a drug…
1-Methylpyrrole, 99%
Product Name : 1-Methylpyrrole, 99%Synonym: IUPAC Name : 1-methyl-1H-pyrroleCAS NO.:96-54-8Molecular Weight : Molecular formula: C5H7NSmiles: CN1C=CC=C1Description: 1-Methylpyrrole, can be used as organic synthetic materials, widely used in medicine.Mefenamic acid It…
Strontium nitrate, 99+%, ACS reagent
Product Name : Strontium nitrate, 99+%, ACS reagentSynonym: IUPAC Name : strontium(2+) dinitrateCAS NO.:10042-76-9Molecular Weight : Molecular formula: N2O6SrSmiles: .Mouse IgG1 kappa, Isotype Control ()=O.Triamterene ()=ODescription: PMID:23551549
5-Benzyloxyindole-3-carboxaldehyde, 98%
Product Name : 5-Benzyloxyindole-3-carboxaldehyde, 98%Synonym: IUPAC Name : 5-(benzyloxy)-1H-indole-3-carbaldehydeCAS NO.Maslinic acid :6953-22-6Molecular Weight : Molecular formula: C16H13NO2Smiles: O=CC1=CNC2=CC=C(OCC3=CC=CC=C3)C=C12Description: Ranibizumab PMID:24463635
1,4-Butane sultone, 99+%
Product Name : 1,4-Butane sultone, 99+%Synonym: IUPAC Name : CAS NO.Remogliflozin etabonate :1633-83-6Molecular Weight : Molecular formula: Smiles: Description: Etanercept PMID:23460641
Diphenylgermanium dichloride, 98+%
Product Name : Diphenylgermanium dichloride, 98+%Synonym: IUPAC Name : CAS NO.Brepocitinib :Molecular Weight : Molecular formula: Smiles: Description: Diphenylgermanium dichloride is used as an organic intermediate.(-)-Epigallocatechin Gallate PMID:23537004
Perfluoro-compound FC-43(TM)
Product Name : Perfluoro-compound FC-43(TM)Synonym: IUPAC Name : tris(1,1,2,2,3,3,4,4,4-nonafluorobutyl)amineCAS NO.Vandetanib :311-89-7Molecular Weight : Molecular formula: C12F27NSmiles: FC(F)(F)C(F)(F)C(F)(F)C(F)(F)N(C(F)(F)C(F)(F)C(F)(F)C(F)(F)F)C(F)(F)C(F)(F)C(F)(F)C(F)(F)FDescription: Voxelotor PMID:23927631
Ethyl 3,4-dihydroxycinnamate, 97%
Product Name : Ethyl 3,4-dihydroxycinnamate, 97%Synonym: IUPAC Name : ethyl (2E)-3-(3,4-dihydroxyphenyl)prop-2-enoateCAS NO.:66648-50-8Molecular Weight : Molecular formula: C11H12O4Smiles: CCOC(=O)C=CC1=CC=C(O)C(O)=C1Description: Ethyl 3,4-dihydroxycinnamate shows anti-inflammatory, immunomodulatory, and anti-carcinogenic properties.Valrubicin It is a potent…
Hydrochloric acid, 0.5N Standardized Solution
Product Name : Hydrochloric acid, 0.5N Standardized SolutionSynonym: IUPAC Name : hydrogen chlorideCAS NO.Dupilumab :7647-01-0Molecular Weight : Molecular formula: ClHSmiles: ClDescription: Hydrochloric acid, 0.Canakinumab 5N standardized solution is used for…
Iganidipine
Product Name : IganidipineSynonym : Chemical Name : CAS NO.: 119687-33-1Molecular formula : C28H38N4O6Molecular Weight: 526.6 g/molClassification : MedChemExpress Products > Life Sciences > IganidipineDescription: Iganidipine is a drug that…
Sn(IV) mesoporphyrin IX dichloride – Bio-X ™
Product Name : Sn(IV) mesoporphyrin IX dichloride - Bio-X ™Synonym : Chemical Name : CAS NO.: 106344-20-1Molecular formula : C34H36Cl2N4O4SnMolecular Weight: 754.29 g/molClassification : MedChemExpress Products > Life Sciences >…
Peretinoin
Product Name : PeretinoinSynonym : Chemical Name : CAS NO.: 81485-25-8Molecular formula : C20H30O2Molecular Weight: 302.45 g/molClassification : MedChemExpress Products > Research Chemicals > PeretinoinDescription: Peretinoin is a synthetic retinoid…
2-Octene, cis + trans, 98%
Product Name : 2-Octene, cis + trans, 98%Synonym: IUPAC Name : (2Z)-oct-2-eneCAS NO.TL1A/TNFSF15, Human :111-67-1Molecular Weight : Molecular formula: C8H16Smiles: CCCCCC=C/CDescription: Megestrol acetate PMID:23075432
Lead(II) acetate, basic, ACS
Product Name : Lead(II) acetate, basic, ACSSynonym: IUPAC Name : tris(λ²-lead(2+)) diacetate tetrahydroxideCAS NO.ALZ-801 :1335-32-6Molecular Weight : Molecular formula: C4H10O8Pb3Smiles: .EML4-ALK kinase inhibitor 1 .PMID:23847952 .....CC()=O.CC()=ODescription: Lead(II) acetate is used…
2,2,3,3,4,4,5,5-Octafluoropentyl methacrylate, 98%, stab.
Product Name : 2,2,3,3,4,4,5,5-Octafluoropentyl methacrylate, 98%, stab.Synonym: IUPAC Name : CAS NO.:355-93-1Molecular Weight : Molecular formula: Smiles: Description: Donepezil Hydrochloride Atazanavir sulfate PMID:23563799
6-Bromohexanoyl chloride, 97%
Product Name : 6-Bromohexanoyl chloride, 97%Synonym: IUPAC Name : 6-bromohexanoyl chlorideCAS NO.:22809-37-6Molecular Weight : Molecular formula: C6H10BrClOSmiles: ClC(=O)CCCCCBrDescription: 6-Bromohexanoyl chloride is used as intermediates, organic synthesis, chemical research, agrochemicals and…
S-Methylisothiouronium sulfate, 98+%
Product Name : S-Methylisothiouronium sulfate, 98+%Synonym: IUPAC Name : bis((methylsulfanyl)methanimidamide); sulfuric acidCAS NO.:867-44-7Molecular Weight : Molecular formula: C4H14N4O4S3Smiles: CSC(N)=N.Pseudouridine CSC(N)=N.Metyrapone OS(O)(=O)=ODescription: PMID:24957087
N-Boc-D-alpha-phenylglycinol, 99%
Product Name : N-Boc-D-alpha-phenylglycinol, 99%Synonym: IUPAC Name : tert-butyl N-carbamateCAS NO.:102089-74-7Molecular Weight : Molecular formula: C13H19NO3Smiles: CC(C)(C)OC(=O)N(CO)C1=CC=CC=C1Description: Telmisartan NPB PMID:24360118
Digoxin, 96%
Product Name : Digoxin, 96%Synonym: IUPAC Name : 4-oxy}-4-hydroxy-6-methyloxan-2-yl]oxy}-4-hydroxy-6-methyloxan-2-yl]oxy}-3a,11-dihydroxy-9a,11a-dimethyl-hexadecahydro-1H-cyclopentaphenanthren-1-yl]-2,5-dihydrofuran-2-oneCAS NO.:20830-75-5Molecular Weight : Molecular formula: C41H64O14Smiles: C1O(C(O)1O)O1(O)C(O2(O)C(O3CC4(C)(CC54C(O)4(C)(CC54O)C4=CC(=O)OC4)C3)O2C)O1CDescription: Digoxin is used in several cardiac pathologies such as atrial fibrillation and heart failure.G36…
Germanium, plasma standard solution, Specpure™ Ge 10,000μg/mL
Product Name : Germanium, plasma standard solution, Specpure™ Ge 10,000μg/mLSynonym: IUPAC Name : CAS NO.:Molecular Weight : Molecular formula: Smiles: Description: Ertugliflozin Abietic acid PMID:23907521
3-(3,4-Dihydroxyphenyl)-2-methyl-L-alanine sesquihydrate
Product Name : 3-(3,4-Dihydroxyphenyl)-2-methyl-L-alanine sesquihydrateSynonym : L-Methyl DopaChemical Name : CAS NO.: 41372-08-1Molecular formula : C10H13NO4•(H2O)1.5Molecular Weight: 238.24 g/molClassification : MedChemExpress Products > Research Chemicals > Building Blocks > Amino…
3,4-Dihydroxybenzoic acid ethyl ester
Product Name : 3,4-Dihydroxybenzoic acid ethyl esterSynonym : Ethyl 3,4-dihydroxybenzoateProtocatechuic acid ethyl esterChemical Name : CAS NO.: 3943-89-3Molecular formula : C9H10O4Molecular Weight: 182.17 g/molClassification : MedChemExpress Products > Research Chemicals…
Sulfo DBCO-PEG4-maleimide
Product Name : Sulfo DBCO-PEG4-maleimideSynonym : Chemical Name : CAS NO.: 2055198-07-5Molecular formula : C39H47N5O13SMolecular Weight: 825.9 g/molClassification : MedChemExpress Products > Research Chemicals > Sulfo DBCO-PEG4-maleimideDescription: Sulfo DBCO-PEG4-maleimide is…
Ethanol-d{6}, 99.5%(Isotopic)
Product Name : Ethanol-d{6}, 99.5%(Isotopic)Synonym: IUPAC Name : (²H₅)ethan-1-(²H)olCAS NO.:1516-08-1Molecular Weight : Molecular formula: C2H6OSmiles: OC()()C()()Description: Persimmon, the fruit treated with ethanol-d_6, thioethers 9d and 9e were obtained, indicating that…
6-Bromo-1,4-benzodioxane, 98%
Product Name : 6-Bromo-1,4-benzodioxane, 98%Synonym: IUPAC Name : 6-bromo-2,3-dihydro-1,4-benzodioxineCAS NO.:52287-51-1Molecular Weight : Molecular formula: C8H7BrO2Smiles: BrC1=CC=C2OCCOC2=C1Description: 6-Bromo-1,4-benzodioxane is used as a pharmaceutical intermediate.Amsacrine Neostigmine methyl sulfate PMID:23558135
N-Methylethylenediamine, 95%
Product Name : N-Methylethylenediamine, 95%Synonym: IUPAC Name : CAS NO.:109-81-9Molecular Weight : Molecular formula: Smiles: Description: N-Methylethylenediamine undergoes condensation with pyridine-2-carboxaldehyde to form an imine.Ulipristal Icatibant PMID:24578169
Carbon disulfide, 99.9%
Product Name : Carbon disulfide, 99.9%Synonym: IUPAC Name : methanedithioneCAS NO.:75-15-0Molecular Weight : Molecular formula: CS2Smiles: S=C=SDescription: Carbon disulfide is used in electronic vacuum tubes, in the manufacturing of carbon…
Palladium, 1% on activated carbon powder, eggshell, reduced, nominally 50% water wet
Product Name : Palladium, 1% on activated carbon powder, eggshell, reduced, nominally 50% water wetSynonym: IUPAC Name : CAS NO.Scopoletin :Molecular Weight : Molecular formula: Smiles: Description: Resiniferatoxin PMID:26446225
Calcium sulfate dihydrate, 98+%, extra pure
Product Name : Calcium sulfate dihydrate, 98+%, extra pureSynonym: IUPAC Name : calcium dihydrate sulfateCAS NO.:10101-41-4Molecular Weight : Molecular formula: CaH4O6SSmiles: O.Bergamottin O.Mangiferin .PMID:32695810 S()(=O)=ODescription:
2-Phenyl-3-butyn-2-ol, 98%
Product Name : 2-Phenyl-3-butyn-2-ol, 98%Synonym: IUPAC Name : 2-phenylbut-3-yn-2-olCAS NO.:127-66-2Molecular Weight : Molecular formula: C10H10OSmiles: CC(O)(C#C)C1=CC=CC=C1Description: Roflumilast Ladiratuzumab PMID:23715856
Cerium(III) carbonate hydrate, REacton™, 99.999% (REO)
Product Name : Cerium(III) carbonate hydrate, REacton™, 99.999% (REO)Synonym: IUPAC Name : dicerium(3+) tricarbonateCAS NO.:54451-25-1Molecular Weight : Molecular formula: C3Ce2O9Smiles: ..C()=O.C()=O.C()=ODescription: Cerium(III) carbonate hydrate is used to prepare cerium chloride…
1,3-Dihydro-5-methyl-6-(4-pyridinyl)-2H-imidazo[4,5-b]pyridin-2-one
Product Name : 1,3-Dihydro-5-methyl-6-(4-pyridinyl)-2H-imidazopyridin-2-oneSynonym : Chemical Name : CAS NO.: 152633-54-0Molecular formula : C12H10N4OMolecular Weight: 226.23 g/molClassification : MedChemExpress Products > Life Sciences > 1,3-Dihydro-5-methyl-6-(4-pyridinyl)-2H-imidazopyridin-2-oneDescription: 1,3-Dihydro-5-methyl-6-(4-pyridinyl)-2H-imidazopyridin-2-one is a potent and…
(3aR,4S,9aS,9Br)-9-(hydroxymethyl)-6-methyl-3-methylidene-2,7-dioxo-2H,3H,3aH,4H,5H,7H,9aH,9bh-azuleno[4,5-b]furan-4-yl 2-(4-hydroxy phenyl)acetate
Product Name : (3aR,4S,9aS,9Br)-9-(hydroxymethyl)-6-methyl-3-methylidene-2,7-dioxo-2H,3H,3aH,4H,5H,7H,9aH,9bh-azulenofuran-4-yl 2-(4-hydroxy phenyl)acetateSynonym : Chemical Name : CAS NO.: 65725-11-3Molecular formula : C23H22O7Molecular Weight: 410.4 g/molClassification : MedChemExpress Products > Research Chemicals > (3aR,4S,9aS,9Br)-9-(hydroxymethyl)-6-methyl-3-methylidene-2,7-dioxo-2H,3H,3aH,4H,5H,7H,9aH,9bh-azulenofuran-4-yl 2-(4-hydroxy phenyl)acetateDescription: (3aR,4S,9aS,9Br)-9-(hydroxymethyl)-6-methyl-3-methylidene-2,7-dioxo-2H,3H,3aH,4H,5H,7H,9aH,9bh-azulenofuran-4-yl…
3-Nitro-L-tyrosine
Product Name : 3-Nitro-L-tyrosineSynonym : Chemical Name : CAS NO.: 621-44-3Molecular formula : C9H10N2O5Molecular Weight: 226.19 g/molClassification : MedChemExpress Products > Research Chemicals > 3-Nitro-L-tyrosineDescription: 3-Nitro-L-tyrosine is an oxidized form…
Mesitylenesulfonic acid sodium salt hemihydrate, 98%
Product Name : Mesitylenesulfonic acid sodium salt hemihydrate, 98%Synonym: IUPAC Name : CAS NO.:6148-75-0Molecular Weight : Molecular formula: Smiles: Description: Atovaquone Glucose dehydrogenase PMID:23907521
Thiamine hydrochloride, 99% (dry wt.), may cont. up to 5% water
Product Name : Thiamine hydrochloride, 99% (dry wt.), may cont. up to 5% waterSynonym: IUPAC Name : hydrogen 3--5-(2-hydroxyethyl)-4-methyl-1,3-thiazol-3-ium dichlorideCAS NO.:67-03-8Molecular Weight : Molecular formula: C12H18Cl2N4OSSmiles: ...CC1=C(CCO)SC=1CC1=CN=C(C)N=C1NDescription: Thiamine hydrochloride plays…
Dimethyl fluoromalonate, 97%
Product Name : Dimethyl fluoromalonate, 97%Synonym: IUPAC Name : CAS NO.:Molecular Weight : Molecular formula: Smiles: Description: Cinacalcet Ensitrelvir PMID:24257686
Poly(methyl-3,3,3-trifluoropropylsiloxane), M.W. 2,400
Product Name : Poly(methyl-3,3,3-trifluoropropylsiloxane), M.W. 2,400Synonym: IUPAC Name : methyl(3,3,3-trifluoropropyl)silanoneCAS NO.:63148-56-1Molecular Weight : Molecular formula: C4H7F3OSiSmiles: C(=O)CCC(F)(F)FDescription: Fluorosilicone lubricantPoly(methyl-3,3,3-trifluoropropylsiloxane) is used in the preparation of siliconized- glass fiber sheets, which…
(3E)-3,7-Dimethylocta-1,3,6-triene
Product Name : (3E)-3,7-Dimethylocta-1,3,6-trieneSynonym : Chemical Name : CAS NO.: 3779-61-1Molecular formula : C10H16Molecular Weight: 136.23 g/molClassification : MedChemExpress Products > Research Chemicals > (3E)-3,7-Dimethylocta-1,3,6-trieneDescription: (3E)-3,7-Dimethylocta-1,3,6-triene is a terpene that…
Littorine
Product Name : LittorineSynonym : Chemical Name : CAS NO.: 21956-47-8Molecular formula : C17H23NO3Molecular Weight: 289.37 g/molClassification : MedChemExpress Products > Research Chemicals > LittorineDescription: Littorine is a natural product…
(E)-2-Octenoic acid
Product Name : (E)-2-Octenoic acidSynonym : Chemical Name : CAS NO.: 1871-67-6Molecular formula : C8H14O2Molecular Weight: 142.2 g/molClassification : MedChemExpress Products > Research Chemicals > (E)-2-Octenoic acidDescription: 2-Octenoic acid is…
Mal-PEG1-bromide
Product Name : Mal-PEG1-bromideSynonym : Chemical Name : CAS NO.: 1823885-81-9Molecular formula : C8H10BrNO3Molecular Weight: 248.07 g/molClassification : MedChemExpress Products > PEG Polymers > Mal-PEG1-bromideDescription: Mal-PEG1-bromide is a PEG (polyethylene…
Astressin 2B
Product Name : Astressin 2BSynonym : Chemical Name : CAS NO.: 681260-70-8Molecular formula : C183H307N49O53Molecular Weight: 4,042 g/molClassification : MedChemExpress Products > Life Sciences > Astressin 2BDescription: Astressin 2B is…
2,4-Difluorobenzaldehyde
Product Name : 2,4-DifluorobenzaldehydeSynonym : Chemical Name : CAS NO.: 1550-35-2Molecular formula : C7H4F2OMolecular Weight: 142.1 g/molClassification : MedChemExpress Products > Research Chemicals > 2,4-DifluorobenzaldehydeDescription: 2,4-Difluorobenzaldehyde is a glycosidic bond…
Vapaliximab
Product Name : VapaliximabSynonym : Chemical Name : CAS NO.: 336801-86-6Molecular formula : Molecular Weight: Classification : MedChemExpress Products > Life Sciences > Antibodies > Monoclonal Antibodies > VapaliximabDescription: Anti-VAP-1…
Amantanium bromide
Product Name : Amantanium bromideSynonym : Chemical Name : CAS NO.: 58158-77-3Molecular formula : C25H46BrNO2Molecular Weight: 472.5 g/molClassification : MedChemExpress Products > Life Sciences > Amantanium bromideDescription: Amantadine is a…
Adenosine 5′-diphosphate
Product Name : Adenosine 5'-diphosphateSynonym : 5'-ADPChemical Name : CAS NO.: 58-64-0Molecular formula : C10H15N5O10P2Molecular Weight: 427.2 g/molClassification : MedChemExpress Products > Nucleosides > Nucleosides, Nucleotides and Nucleic acids >…
5 and participation of phenol compounds in antioxidant scavenging mechanism (Figure 6C
5 and participation of phenol compounds in antioxidant scavenging mechanism (Figure 6C). The enhanced GB content seen in Tibetan wild barley may possibly defend on enzyme activity, such as enzymes…
Enter, Beijing 100191, China; dDepartment of Plant Biology, Carnegie Institution for Science
Enter, Beijing 100191, China; dDepartment of Plant Biology, Carnegie Institution for Science, Stanford, CA 94305; eInstitute of Plant Genetics, National Study Council of Italy, 90123 Palermo, Italy; and fLeibniz Institute…
Advantame
Product Name : AdvantameSynonym : Chemical Name : CAS NO.: 245650-17-3Molecular formula : C24H30N2O7Molecular Weight: 458.5 g/molClassification : MedChemExpress Products > Research Chemicals > AdvantameDescription: Advantame is a high-intensity sweetener…
Meclofenamate sodium hydrate
Product Name : Meclofenamate sodium hydrateSynonym : Chemical Name : CAS NO.: 67254-91-5Molecular formula : C14H12Cl2NNaO3Molecular Weight: 336.1 g/molClassification : MedChemExpress Products > Impurities > Meclofenamate sodium hydrateDescription: Meclofenamate sodium…
3,4′-Dihydroxy-3,5′,7-trimethoxyflavan
Product Name : 3,4'-Dihydroxy-3,5',7-trimethoxyflavanSynonym : Chemical Name : CAS NO.: 97914-19-7Molecular formula : C18H20O6Molecular Weight: 332.3 g/molClassification : MedChemExpress Products > Natural Products > 3,4'-Dihydroxy-3,5',7-trimethoxyflavanDescription: 3,4'-Dihydroxy-3,5',7-trimethoxyflavan is a natural product…
7 fragment of mature IL1B additional confirmed the ELISA final results (Fig.
7 fragment of mature IL1B additional confirmed the ELISA outcomes (Fig. 5B). Additionally, we identified that activation of CASP1 (as indicated by the presence with the cleaved form and enzyme…
84.Ki [mM]0.03160.001 0.8160.n1.960.1 2.060.Ks [mM]3.660.5 4.160.Kis [mM]3567b 0.6360.08 0.5760.kcat (s21)21.762.2 24.762.The
84.Ki 0.03160.001 0.8160.n1.960.1 2.060.Ks 3.660.5 4.160.Kis 3567b 0.6360.08 0.5760.kcat (s21)21.762.2 24.762.The dissociation constant of the enzyme-substrate complex (Ks), the inhibition constant of FBPase by its substrate (Kis) and b values…
T neocortical areas (Bancher et al. 1993). Recently, the interneuronal transmission of
T neocortical areas (Bancher et al. 1993). Recently, the interneuronal transmission of tau pathology was reported in vitro whereby exogenously added tau fibrils were internalized into host cells and induced…
He blot was developed by use of the SuperSignal Ultra chemiluminescence
He blot was developed by use of the SuperSignal Ultra chemiluminescence detection system (Pierce) and recorded by the use of Hyperfilm ECL (Amersham Biosciences).Glucose uptake assay Glucose uptake rates were…
Showed higher levels (P = 0.01) of E. coli 55989a-s colonization compared to
Showed higher levels (P = 0.01) of E. coli 55989a-s colonization in comparison to mice precolonized with wild-type MG1655-s control (Fig. 5B and 4B respectively)DiscussionIncreased susceptibility to enteric infection just…
TD and compared it for the expressions in nearby key blood
TD and compared it to the expressions in nearby significant blood vessels, the aorta and vena cava. To establish the location of PKG protein expression we performed immunohistochemistry of frozen,…
Ncorporation inside ten min. Similarly, Liu et al. revealed that demineralized dentin
Ncorporation inside 10 min. Similarly, Liu et al. revealed that demineralized dentin slabs continuously gained weight when being immersed in 3.75 PA for ten s 720 min.10 In accordance with…
Eserine sulfate
Product Name : Eserine sulfateSynonym : Chemical Name : CAS NO.: 64-47-1Molecular formula : C30H44N6O8SMolecular Weight: 648.77 g/molClassification : MedChemExpress Products > Research Chemicals > Eserine sulfateDescription: Eserine sulfate is…
Trimethylsilyl-meso-inositol
Product Name : Trimethylsilyl-meso-inositolSynonym : Chemical Name : CAS NO.: 2582-79-8Molecular formula : C24H60O6Si6Molecular Weight: 613.24 g/molClassification : MedChemExpress Products > Carbohydrates > Monosaccharides > Trimethylsilyl-meso-inositolDescription: Trimethylsilyl-meso-inositol is a metabolite…
NG 52
Product Name : NG 52Synonym : Chemical Name : CAS NO.: 212779-48-1Molecular formula : C16H19ClN6OMolecular Weight: 346.81 g/molClassification : MedChemExpress Products > Research Chemicals > NG 52Description: NG 52 is…
Sm by which AM induces vasorelaxation or erection varies with species
Sm by which AM induces vasorelaxation or erection varies with species, vascular bed studied, and experimental method employed. The AM process is postulated to have a cardioprotective function within a…
Nts are created in the wet natural environment, rather than the
Nts are created in a moist natural environment, instead of the dry formats of several other arrays, this design and style is amongst the few lectin arrays that will be…
(Figure 1B). Though it is nicely established that Trpm5 serves this
(Figure 1B). Despite the fact that it is nicely established that Trpm5 serves this function in mammalian taste cells (Talavera et al. 2005), our benefits present the initial evidence that…
Ed for 1 h at RT.Proteins have been separated on a hand-cast
Ed for 1 h at RT.Proteins had been separated on a hand-cast 12 polyacrylamide Tris-glycine gel. Soon after silver staining as described in reference 25, visible bands had been cut…
Aspects for LRR in the post-mastectomy setting to ensure that sufferers with
Components for LRR inside the post-mastectomy setting so that individuals with these components can expertise the greatest benefit from PMRT.Limitations of This StudyOur study has some limitations. Firstly, we failed…
(Table 1). In quite a few systems, N-myristoylation and palmitoylation market proteinmembrane interactions. AtCPK
(Table 1). In lots of systems, N-myristoylation and palmitoylation promote proteinmembrane interactions. AtCPK2, AtCPK10, AtCPK3, TaCPK2 and TaCPK5 have been predicted to have an N-myristoylation motif and have been shown…
). Interestingly, only the extended isoform with the Sox5 protein (MW: 80 kDa
). Interestingly, only the long isoform from the Sox5 protein (MW: 80 kDa), but not the short isoform (MW: 48 kDa), was detected and up-regulated in TRAF3-/-B lymphomas. We next…
N-(Amino-PEG4)-N-bis(PEG4-t-butyl ester)
Product Name : N-(Amino-PEG4)-N-bis(PEG4-t-butyl ester)Synonym : Chemical Name : CAS NO.: 2093153-97-8Molecular formula : C40H80N2O16Molecular Weight: 845.1 g/molClassification : MedChemExpress Products > Research Chemicals > N-(Amino-PEG4)-N-bis(PEG4-t-butyl ester)Description: N-(Amino-PEG4)-N-bis(PEG4-t-butyl ester) is…
Bavisant dihydrochloride
Product Name : Bavisant dihydrochlorideSynonym : Chemical Name : CAS NO.: 929622-09-3Molecular formula : C19H29Cl2N3O2Molecular Weight: 402.4 g/molClassification : MedChemExpress Products > Life Sciences > Bavisant dihydrochlorideDescription: Bavisant dihydrochloride is…
Silybin B
Product Name : Silybin BSynonym : Chemical Name : CAS NO.: 142797-34-0Molecular formula : C25H22O10Molecular Weight: 482.44 g/molClassification : MedChemExpress Products > Life Sciences > Biological Reagents > IHC Reagents…
SP844 physiological stress transducers (Memscap AS, Scoppum, Norway) and bridge amplifiers
SP844 physiological pressure transducers (Memscap AS, Scoppum, Norway) and bridge amplifiers connected to PowerLab 16/30 technique with LabChart Pro 7.0 application (AD Instruments, Inc., Colorado Springs, CO). Correct positioning with…
Lts in extended suppression of renal illness for no less than 4 weeks
Lts in extended suppression of renal illness for no less than 4 weeks (56). The administration of fostamatinib following the improvement of illness also improves kidney damage in New Zealand…
Nsemble Docking, and Typical XP DockingWe compared the binding scores obtained
Nsemble Docking, and Standard XP DockingWe compared the binding scores obtained with distinct docking approaches and also the reported activity of SAH, SGI-1027, and CBC12. Table 2 summarizes the docking…
Encapsulated into the Cvt vesicle that fuses with the vacuole. Exposure
Encapsulated into the Cvt vesicle that fuses with the vacuole. Exposure to the acidic pH of the vacuolar lumen results in disassembly of the preApe1 complex to preApe1 dodecamers.131 Finally,…
D/or antagonist SCH 58261 (50 nM). A, The activation of A2ARs
D/or antagonist SCH 58261 (50 nM). A, The activation of A2ARs by CGS 21680 in cortical gliosomes (open symbols) reduces NKA activity, whereas it increases NKA activity in synaptosomes (closed…
Induction of synaptic plasticity at excitatory synapses onto principal neurons (Kirkwood
Induction of synaptic plasticity at excitatory synapses onto principal neurons (Kirkwood and Bear, 1994; Rozas et al., 2001; Artola and Singer, 1987; Jang et al., 2009).2013 Elsevier Inc. All rights…
:100; Santa-Cruz Biotechnology), anti-3-Nitrotyrosine (1:one hundred; Millipore), and anti-CD11b (1:100; Hybridoma Bank, Iowa
:100; Santa-Cruz Biotechnology), anti-3-Nitrotyrosine (1:100; Millipore), and anti-CD11b (1:100; Hybridoma Bank, Iowa City, IA). The secondary antibodies incorporated biotinylated secondary antibodies (1:200; Vector Laboratories, Burlingame, CA) and FITC-conjugated avidin (1:200;…
Materials/analysis tools: LJX FFZ. Wrote the paper: LJX YBL.Sensitivity
Materials/analysis tools: LJX FFZ. Wrote the paper: LJX YBL.Sensitivity evaluation of trials evaluating GFR alterations with newer vitamin D compounds therapy showed a low level of sensitivity. (TIF)Figure S Int.…
Rituximab – 10mg/ml solution
Product Name : Rituximab - 10mg/ml solutionSynonym : Chemical Name : CAS NO.: 174722-31-7Molecular formula : C6416H9874N1688O1987S44Molecular Weight: 143.86 kg/molClassification : MedChemExpress Products > Life Sciences > Antibodies > Monoclonal…
Dimethyl trisulphide
Product Name : Dimethyl trisulphideSynonym : Chemical Name : CAS NO.: 3658-80-8Molecular formula : C2H6S3Molecular Weight: 126.27 g/molClassification : MedChemExpress Products > Research Chemicals > Dimethyl trisulphideDescription: Dimethyl trisulphide is…
Betahistine dihydrochloride
Product Name : Betahistine dihydrochlorideSynonym : Chemical Name : CAS NO.: 5579-84-0Molecular formula : C8H12N2·2HClMolecular Weight: 209.12 g/molClassification : MedChemExpress Products > Research Chemicals > Betahistine dihydrochlorideDescription: Betahistine dihydrochloride is…
S performed making use of the RNeasy mini kit from Qiagen, based on
S performed using the RNeasy mini kit from Qiagen, according to the manufacturer's instructions. The RNA concentration and purity had been determined by the absorbance ratio at 280 and 260…
Sidered to become substantial. Mechanical sensitivity final results are reported as indicates
Sidered to be important. Mechanical sensitivity outcomes are reported as means E with the threshold (g) on the head withdrawal reflex testing. To analyze the outcomes in the nociceptive sensitivity…
Sis by reducing myosin 7 expression and strengthen survival in Dahl salt-sensitivePLOS
Sis by decreasing myosin 7 expression and boost survival in Dahl salt-sensitivePLOS One | www.plosone.orgrats . miR-21 inhibitors have been effective in suppressing extracellular matrix production in several ailments for…
Ts whose DNA was collected, 353 subjects taking niacin or fibrates had been
Ts whose DNA was collected, 353 subjects taking niacin or fibrates were excluded since of their effects on HDL-C and triglycerides and 185 were excluded resulting from genotyping failure yielding…
Organelle marker antibodies (Supplemental Table S1).Recombinant Protein PurificationA construct for
Organelle marker antibodies (Supplemental Table S1).Recombinant Protein PurificationA construct for bacterial expression of CPA and CPB from the very same plasmid and identical promoters was described previously (Huang et al.,…
Monolinguals vs. late bilinguals in nonword repetition efficiency so as to
Monolinguals vs. late bilinguals in nonword repetition functionality as a way to investigate possible differences in behavioral and kinematic performance. The findings also reveal a function for the speech motor…
S. In silico analyses revealed that the proximal regulatory region of
S. In silico analyses revealed that the proximal regulatory area of human NIS gene consists of several responsive components to p53. Right here, we show that NIS gene is often…
(n = five); P 0.05; considerable when compared with hyperglycemic handle animals.Hossain et al.
(n = five); P 0.05; considerable in comparison with hyperglycemic control animals.Hossain et al. BMC Complementary and Alternative Medicine 2014, 14:169 http://www.biomedcentral/1472-6882/14/Page 4 ofTable two Analgesic effect of crude methanol…
Monotropein
Product Name : MonotropeinSynonym : Chemical Name : CAS NO.: 5945-50-6Molecular formula : C16H22O11Molecular Weight: 390.34 g/molClassification : MedChemExpress Products > Natural Products > Terpenes > MonotropeinDescription: Monotropein is a…
Thioperamide
Product Name : ThioperamideSynonym : Chemical Name : CAS NO.: 106243-16-7Molecular formula : C15H24N4SMolecular Weight: 292.44 g/molClassification : MedChemExpress Products > Research Chemicals > ThioperamideDescription: Thioperamide is a histamine H3…
4-[2-[[5-[(Dimethylamino)methyl]furan-2-yl]methylsulfanyl]ethylimino]-1-oxido-1,2,5-thiadiazol-1-ium-3-amine
Product Name : 4-furan-2-yl]methylsulfanyl]ethylimino]-1-oxido-1,2,5-thiadiazol-1-ium-3-amineSynonym : Chemical Name : CAS NO.: 78441-82-4Molecular formula : C12H19N5O2S2Molecular Weight: 329.4 g/molClassification : MedChemExpress Products > Life Sciences > 4-furan-2-yl]methylsulfanyl]ethylimino]-1-oxido-1,2,5-thiadiazol-1-ium-3-amineDescription: 4-furan-2-yl]methylsulfanyl]ethylimino]-1-oxido-1,2,5-thiadiazol-1-ium-3-amine (PD 03055) is an…
Cross section, (b) surface view of CAB-12 w/v, PG-10 v
Cross section, (b) surface view of CAB-12 w/v, PG-10 v/v, (c) surface view of CAB-12 w/v, PG-15 v/v, and (d) surface view of CAB-12 w/v, PG-20 v/v.shifts within the stretching…
Or this phenomenon is an ammoniadependent substrate amination activity of HisFCg
Or this phenomenon is definitely an ammoniadependent substrate amination activity of HisFCg in vivo (Fig. 1). Our findings support this theory, considering the fact that hisFCg is in a position…
D G6P availability in skeletal muscles. Because STZ rats were
D G6P availability in skeletal muscles. Considering the fact that STZ rats had been treated with AICAR for 7 consecutive days, it allowed for the progressive create up of muscle…
S, 1.67 l of input RNA, 0.four l of ten mM dNTPs, 0.three l of
S, 1.67 l of input RNA, 0.4 l of ten mM dNTPs, 0.three l of reverse transcriptase, 0.5 l of 10buffer, 0.6 l of RNAse inhibitor diluted 1:10 and 0.5…
TL), but additionally the follicular variant of peripheral T-cell lymphoma, not
TL), but in addition the follicular variant of peripheral T-cell lymphoma, not otherwise specified (PTCL-NOS), and major CD4positive tiny medium cutaneous T-cell lymphoma. Although all are accepted as clonal and…
Onstruct abbreviations as in Figure four. Information represent mean six SD of a
Onstruct abbreviations as in Figure four. Data represent imply six SD of a single representative experiment (N = 2 replicates), repeated 3 occasions (N = 2 replicates) with comparable results.…
Lation in vivo, we injected Sirt2 siRNA into mice through the
Lation in vivo, we injected Sirt2 siRNA into mice via the tail vein, and Sirt2 was effectively reduced in the mouse livers by western blot analysis (Figure 3F). We discovered…
Trifolirhizin
Product Name : TrifolirhizinSynonym : Chemical Name : CAS NO.: 6807-83-6Molecular formula : C22H22O10Molecular Weight: 446.4 g/molClassification : MedChemExpress Products > Natural Products > Pterocarpans > TrifolirhizinDescription: Trifolirhizin is a…
Calcium levofolinate
Product Name : Calcium levofolinateSynonym : Chemical Name : CAS NO.: 80433-71-2Molecular formula : C20H21CaN7O7Molecular Weight: 511.5 g/molClassification : MedChemExpress Products > Research Chemicals > Calcium levofolinateDescription: Calcium levofolinate is…
Monochlorobimane
Product Name : MonochlorobimaneSynonym : mBClChemical Name : CAS NO.: 76421-73-3Molecular formula : C10H11ClN2O2Molecular Weight: 226.66 g/molClassification : MedChemExpress Products > Research Chemicals > MonochlorobimaneDescription: Monochlorobimane is a reactive chemical…
Istologically, the squamous metaplasia was characterized by distal colonic crypts lined
Istologically, the squamous metaplasia was characterized by distal colonic crypts lined by squamous epithelium (Figure 4H). The distal colonic hyperplastic and metaplastic lesions had variable galectin-3 staining with regions of…
Sing the GUS transcript. The specific primers utilized for real-time PCR
Sing the GUS transcript. The unique primers applied for real-time PCR are listed in Supplemental Table S9. Plant Physiol. Vol. 179,Assays of Sensitivity to ABA and Osmotic StressFor tests of…
Se groups, respectively. There was also no distinction in28-day mortality
Se groups, respectively. There was also no distinction in28-day mortality among the sufferers who received high-dose and low-dose corticosteroids (Table three). There was a substantial difference in 28-day mortality in…
Njury and persisted by way of eight weeks post-injury. The data had been analyzed
Njury and persisted through eight weeks post-injury. The data have been analyzed making use of a two-way ANOVA followed by Bonferroni posttests, with the F15,158 = 3.098, all p,0.05 inside…
Tors (Fig. 6). The one-way ANOVA showed that there had been substantial variations
Tors (Fig. six). The one-way ANOVA showed that there had been important variations between the group suggests. The Tukey post-hoc test showed that there was a significant distinction in between…
Ly active FOXO3 expressed in transgenic mice suppresses follicular maturation and
Ly active FOXO3 expressed in transgenic mice suppresses follicular maturation and largely prevents ovulation . DAF-16/FOXO may also have an effect on the delivery of polyunsaturated fatty acids to oocytes…
Meiosis, Mfc1 is identified in the forespore membrane, along with the use
Meiosis, Mfc1 is discovered at the forespore membrane, as well as the use from the coppersensor-1 tracker suggests that it transports copper into the forespore (3, 40). In a manner…
E polyvinyl chloride (PVC) bags have been prepared for each concentration. Contents
E polyvinyl chloride (PVC) bags had been ready for each and every concentration. Contents from each and every of those 6 admixtures have been ready and analyzed in duplicate for…
NLRP3i
Product Name : NLRP3iSynonym : 5-Chloro-2-methoxy-N-(4-sulfamoylphenethyl)benzamideGlibenclamide impurity AChemical Name : CAS NO.: 16673-34-0Molecular formula : C16H17ClN2O4SMolecular Weight: Classification : MedChemExpress Products > Impurities > iGlibenclamide > NLRP3iDescription: NLRP3i is a…
Biil-260 hydrochloride
Product Name : Biil-260 hydrochlorideSynonym : Chemical Name : CAS NO.: 192581-24-1Molecular formula : C30H31ClN2O3Molecular Weight: 503 g/molClassification : MedChemExpress Products > Life Sciences > Biil-260 hydrochlorideDescription: BIIL-260 hydrochloride is…
6-Methoxy-3,5,7,4′-tetrahydroxyflavone
Product Name : 6-Methoxy-3,5,7,4'-tetrahydroxyflavoneSynonym : 3, 5, 7-Ttrihydroxy- 2- (4- hydroxyphenyl) - 6- methoxy-4H- 1- Benzopyran- 4- oneChemical Name : CAS NO.: 32520-55-1Molecular formula : C16H12O7Molecular Weight: 316.26 g/molClassification :…
Reports recommend that, in inflammatory situations, CECs could also act as
Reports suggest that, in inflammatory conditions, CECs may well also act as antigen-presenting cells within the nearby colonic immune response . Right here, we made use of a human CEC…
Unc13 isoforms (Deng et al., 2011; Chen et al., 2013; Hu et al.
Unc13 isoforms (Deng et al., 2011; Chen et al., 2013; Hu et al., 2013; Lipstein et al., 2013). The non-calcium binding C2A domain of UNC-13/Munc13 serves as protein interacting domain…
Tients. Although pain is usually a frequent feature, it is actually generally under-reported
Tients. Despite the fact that pain is often a common function, it's typically under-reported and undertreated. On the other hand, lots of effective therapies exist for DNP, like medicines developed…
Port; Kay Zander, MA and Ellen O’Malley, MS of CoAxia
Port; Kay Zander, MA and Ellen O'Malley, MS of CoAxia, Inc for worthwhile input, critique, and editing from the manuscript. Funding CoAxia, Inc supplied funding for the SENTIS trial. The…
). Collectively, these information demonstrate that tRNA thiolation, and not protein urmylation
). Collectively, these information demonstrate that tRNA thiolation, and not protein urmylation, is very important for the coordination of development and metabolic cycling beneath difficult nutrient environments. tRNA uridine thiolation…
Ratios in between human CD4 and CD8 T cells. aGVHD improvement was
Ratios amongst human CD4 and CD8 T cells. aGVHD development was determined by examining features each day including body weight, ruffled fur, locomotor activity, posture and diarrhoea. Animals that displayed…
Orders in the elderly, such as post-stroke dementia, multi-infarct dementia, subcortical ischemic
Orders inside the elderly, like post-stroke dementia, multi-infarct dementia, subcortical ischemic vascular disease and dementia, mild cognitive impairment, and in some cases Alzheimer's illness (Gorelick et al., 2011). Cerebrovascular alterations…
rac-Paroxetine-d4 hydrochloride
Product Name : rac-Paroxetine-d4 hydrochlorideSynonym : Chemical Name : CAS NO.: 1217683-35-6Molecular formula : C19H21ClFNO3Molecular Weight: 369.8 g/molClassification : MedChemExpress Products > Life Sciences > rac-Paroxetine-d4 hydrochlorideDescription: Rac-Paroxetine-d4 hydrochloride is…
Hec1/Nek2 Mitotic Pathway Inhibitor I, INH1
Product Name : Hec1/Nek2 Mitotic Pathway Inhibitor I, INH1Synonym : Chemical Name : CAS NO.: 313553-47-8Molecular formula : C18H16N2OSMolecular Weight: 308.4 g/molClassification : MedChemExpress Products > Research Chemicals > Hec1/Nek2…
Tripelennamine
Product Name : TripelennamineSynonym : Chemical Name : CAS NO.: 91-81-6Molecular formula : C16H21N3Molecular Weight: 255.36 g/molClassification : MedChemExpress Products > Life Sciences > Ligands > Histamine Receptors > TripelennamineDescription:…
Pathways identified in this certain population cannot be sufficiently emphasized simply because
Pathways identified within this particular population can't be sufficiently emphasized simply because they could represent a safeguard mechanism mediating the protection from the breast conferred by full term pregnancy. Keyword…
Ninfected animal, overt carious lesions are absent, though “white spots” (pretty
Ninfected animal, overt carious lesions are absent, while "white spots" (extremely early lesions) commence to seem in some localized places.coinfected and C. albicans-infected groups (P, 0.05). Though statistically substantial, this…
Nd 570LP and 585/42BP filters (350 V). Hoechst 33342 was excitedJanuary 2014 Volume 58 Numberaac.
Nd 570LP and 585/42BP filters (350 V). Hoechst 33342 was excitedJanuary 2014 Volume 58 Numberaac.asm.orgLee et al.Veh 30 nM CQ three 30 DSP CPZ PMZ 4HT*** *** *** *** ***…
S et al.Pagerandomized study from the German Hodgkin Study Group
S et al.Pagerandomized study on the German Hodgkin Study Group (GHSG), a TRM price of 9 for COPP (cyclophosphamide, oncovin, procarbazine, prednisone)-ABVD mixture therapy and 21 for BEACOPP (bleomycin, etoposide,…
A. C. Kudi, in addition to a. J. Moody, “Spontaneous reactivation and aging
A. C. Kudi, plus a. J. Moody, "Spontaneous reactivation and aging kinetics of acetylcholinesterase inhibited by dichlorvos and diazinon," The Journal of Toxicological Sciences, vol. 36, no. two, pp. 23741,…
Arfel KA: Mucinous breast carcinomas with abundant intracytoplasmic mucin and neuroendocrine
Arfel KA: Mucinous breast carcinomas with abundant intracytoplasmic mucin and neuroendocrine functions: light microscopic, immunohistochemical, and ultrastructural study. Ultrastruct Pathol 1987, 11:298. 65. Ersahin C, Bandyopadhyay S, Bhargava R: Thyroid…
Totic suppression (Zhang et al., 2008). Regarding SA, its function in wound
Totic suppression (Zhang et al., 2008). Concerning SA, its function in wound responses hasFHT is induced by injuryTissues react to injury by forming a suberized and lignified closing layer which…
Wild Type+ + + + + +-( 16 ), F264T ( 30 ), and F264W ( 18 ) (Table 1). There were
Wild Type+ + + + + +-( 16 ), F264T ( 30 ), and F264W ( 18 ) (Table 1). There had been quite a few mutations that had been…
(Lys8-psi(CH2NH)Lys9)-Neurotensin (8-13)
Product Name : (Lys8-psi(CH2NH)Lys9)-Neurotensin (8-13)Synonym : H-Lys-psi(CH2NH)Lys-Pro-Tyr-Ile-Leu-OHChemical Name : CAS NO.: 139026-66-7Molecular formula : C38H66N8O7Molecular Weight: 746.98 g/molClassification : MedChemExpress Products > Research Chemicals > (Lys8-psi(CH2NH)Lys9)-Neurotensin (8-13)Description: Neurotensin (NT) is…
Hinokitiol
Product Name : HinokitiolSynonym : Chemical Name : CAS NO.: 499-44-5Molecular formula : C10H12O2Molecular Weight: 164.2 g/molClassification : MedChemExpress Products > Research Chemicals > HinokitiolDescription: Hinokitiol is a natural compound…
E4CPG
Product Name : E4CPGSynonym : Chemical Name : CAS NO.: 170846-89-6Molecular formula : C11H13NO4Molecular Weight: 223.23 g/molClassification : MedChemExpress Products > Life Sciences > Ligands > E4CPGDescription: E4CPG is an…
Iomol Chem. 2006; 4:1746754. [PubMed: 16633567] 14. Wang M, Pinnamaraju S, Ranganathan R, Hajdu J.
Iomol Chem. 2006; four:1746754. 14. Wang M, Pinnamaraju S, Ranganathan R, Hajdu J. Chem Phys Lipids. 2013; 172:785. 15. (a) Chen HJ, Chen CY, Gao P, Wu Y. Tetrahedron. 2013;…
Osphorylation To study the involvement of visfatin in TNF-mediated effects on
Osphorylation To study the involvement of visfatin in TNF-mediated effects on glucose metabolism, we measured 2-deoxyglucose uptake in 3T3-L1 adipocytes treated with TNF alone or pretreated withAdipocyteVolume three Issue014 Landes…
N two 1 Not applicable Not applicable 1 Not seizure-free (11 years) Not seizure-free (ten years
N two 1 Not applicable Not applicable 1 Not seizure-free (11 years) Not seizure-free (10 years) 1 UnknownSPS, straightforward partial seizure; SGS, secondary generalized seizures; CPS, complicated partial seizures; FS,…
0001 0.0001 0.0001 0.94 0.09 0.94 0.22 0.20 0.06 0.62 0.013 0.035 0.013 0.29 0.12 0.0006 0.41 0.04 0.86 0.49 0.72 0.38 0.50 0.40 0.85 0.0008 0.56 0.13 0.36 0.023 0.33 0.Physical and clinical traits Gender (M/F) Age (year) BMI (kg
0001 0.0001 0.0001 0.94 0.09 0.94 0.22 0.20 0.06 0.62 0.013 0.035 0.013 0.29 0.12 0.0006 0.41 0.04 0.86 0.49 0.72 0.38 0.50 0.40 0.85 0.0008 0.56 0.13 0.36 0.023…
Ound in human RA [30]. Remedy with solomonsterol A decreased the degree
Ound in human RA . Therapy with solomonsterol A lowered the degree of joint harm by decreasing the expression of inflammatory mediators. One of the most exciting finding was that…
Ller volume of extracellular fluid surrounding neighboring cells. Catecholamine production and
Ller volume of extracellular fluid surrounding neighboring cells. Catecholamine production and secretion may possibly also be augmented in the in situ epithelial environment. Though the present investigation was conducted in…
ON core. It is actually probably that this shell will deliver protection
ON core. It is actually probably that this shell will deliver protection for a number of phases of iron oxide, including Fe3O4 or -Fe2O3 (each phases are typically employed as…
(+)-Catechin
Product Name : (+)-CatechinSynonym : (2R,3S)-2-(3,4-Dihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol(+)-3,3',4',5,7-FlavanpentolChemical Name : CAS NO.: 154-23-4Molecular formula : C15H14O6Molecular Weight: 290.27 g/molClassification : MedChemExpress Products > Natural Products > Catechins > (+)-CatechinDescription: Catechin is a…
Nikkomycin Z from streptomyces tendae
Product Name : Nikkomycin Z from streptomyces tendaeSynonym : Chemical Name : CAS NO.: 59456-70-1Molecular formula : C20H25N5O10Molecular Weight: 495.4 g/molClassification : MedChemExpress Products > Antimicrobials > Nikkomycin Z from…
8-Epixanthatin
Product Name : 8-EpixanthatinSynonym : Chemical Name : CAS NO.: 30890-35-8Molecular formula : C15H18O3Molecular Weight: 246.30 g/molClassification : MedChemExpress Products > Natural Products > 8-EpixanthatinDescription: 8-Epixanthatin is a natural product…
D recommendations. Additionally, far better cooperation among all stakeholdersmanufacturers, importers/exporters, distributors
D suggestions. Additionally, better cooperation among all stakeholdersmanufacturers, importers/exporters, distributors, regulators, and indeed the customer should be promoted via frequent education and education. Results obtained from the SQ-TLC assays have…
Ub-aldehyde and Ub-VS failed to inhibit degradation of model substrates [75, 76]. RPN
Ub-aldehyde and Ub-VS failed to inhibit degradation of model substrates . RPN11 acts as an endopeptidase, cleaving poly-Ub chains en bloc from substrates, and its activity inside proteasomes is dependent…
OA-D34, n = 147; PA-D31 + AA-D8, n = 226. (e) The incorporation price of PA-D
OA-D34, n = 147; PA-D31 + AA-D8, n = 226. (e) The incorporation price of PA-D31 isn't impacted by the presence of AA-D8. PA-D31 alone, n = 127; PA-D31 +…
Ected as high positive DRMSF values. On the other hand, DRMSF
Ected as high positive DRMSF values. On the other hand, DRMSF of PaNTD with ATP or ADP bound states where quite similar (Figure 4B, dotted line). This is reflected as…
As a result of scattering, the bead couldn’t be imaged via standard
As a consequence of scattering, the bead could not be imaged by way of conventional epifluorescence (Fig. 4b). To obtain a TROVE image, we made use of a photomultiplier tube…
Losone.orgDSF activated the ROS-p38 MAPK pathway in tumor-initiating HCC cells.
Losone.orgDSF activated the ROS-p38 MAPK pathway in tumor-initiating HCC cells. As anticipated, the therapy of EpCAM+ HCC cells with NAC canceled p38 activation. Additionally, the SB203580 therapy largely restored the…
Th slow orbital shaking. Tissue acid lysates have been then diluted to
Th slow orbital shaking. Tissue acid lysates had been then diluted to five HNO3 with OmniTrace water (EMD Chemical compounds), clarified by centrifugation (3000 g for 10 min), and introduced…
RX 821002 hydrochloride
Product Name : RX 821002 hydrochlorideSynonym : Chemical Name : CAS NO.: 109544-45-8Molecular formula : C12H14N2O3·HClMolecular Weight: 270.71 g/molClassification : MedChemExpress Products > Life Sciences > Ligands > RX 821002…
Fluticasone furoate EP impurity G
Product Name : Fluticasone furoate EP impurity GSynonym : Chemical Name : CAS NO.: 220589-37-7Molecular formula : C43H51F5O8SMolecular Weight: 822.92 g/molClassification : MedChemExpress Products > Impurities > Fluticasone furoate EP…
(S)-6,7-Dihydro-2-nitro-6-[[4-(trifluoromethoxy)phenyl]methoxy]-5H-imidazo[2,1-b][1,3]oxazine
Product Name : (S)-6,7-Dihydro-2-nitro-6-methoxy]-5H-imidazooxazineSynonym : (6S)-6,7-Dihydro-2-nitro-6-methoxy]-5H-imidazooxazine Pretomanid(S)-PA 824Chemical Name : CAS NO.: 187235-37-6Molecular formula : C14H12F3N3O5Molecular Weight: 359.26 g/molClassification : MedChemExpress Products > Antimicrobials > Antibiotics > (S)-6,7-Dihydro-2-nitro-6-methoxy]-5H-imidazooxazineDescription: (S)-6,7-Dihydro-2-nitro-6-methoxy]-5H-imidazooxazine is…
Zation of V2R with M6PR and Vps26 (Fig. 3, E
Zation of V2R with M6PR and Vps26 (Fig. three, E and F, respectively). These information demonstrate that LGR5 is constitutively internalized through retromer good endosomes and delivered for the TGN.…
Ealthcare Common Process Coding Technique (HCPCS), and International Classification of Diseases
Ealthcare Widespread Procedure Coding Method (HCPCS), and International Classification of Diseases, 9th Revision, Clinical Modification (ICD-9CM) codes: CPT 443889, 443924, 45378, 45380, 453825; HCPCS G0105, G0121; ICD-9-CM 45.23, 45.25, 45.27,…
The UmeCentre for International Well being Analysis, funded by FAS, the Swedish
The UmeCentre for Global Well being Investigation, funded by FAS, the Swedish Council for Operating Life and Social Analysis (Grant no. 2006512). Author specifics 1 Deputy head for Tigray Regional…
Ge but IgJ chain was increased.Serum Biomarker in Viral Hepatitis
Ge but IgJ chain was elevated.Serum Biomarker in Viral Hepatitis4. ResultsIn the present study, serum proteome analysis was carried out for 7 wholesome folks and 19 HCV-positive individuals in three…
He sufferers mutation within the gene. C: Box plot displaying clinical
He sufferers mutation within the gene. C: Box plot displaying clinical grading scales (CGS) based on the location with the ryanodine receptor sort 1 mutation. Boxes delineate the inter-quartile variety…
History studies of 1,905 cirrhotic sufferers [30-38]. The baseline likelihood of creating
History studies of 1,905 cirrhotic patients . The baseline likelihood of creating HCC from DC was estimated from a study by Planas et al. that followed 200 patients with DC.…
Ells had been IL-21R+/+ but T cells were IL-21R2/2, addition
Ells had been IL-21R+/+ but T cells have been IL-21R2/2, addition of IL-21 retained the capacity to upregulate CD86 (Fig. 2A, third panels). Moreover, preventing B cells alone from getting…
Agy has been implicated as an inhibitor of each apoptosis and
Agy has been implicated as an inhibitor of both apoptosis and necrosis by preserving cellular functions, removing toxic debris, and keeping cellular power charge. Nevertheless, proapoptotic roles of autophagy have…
D-[UL-¹³C6]mannose
Product Name : D-mannoseSynonym : D-Mannose-U-¹³C6Chemical Name : CAS NO.: 287100-74-7Molecular formula : ¹³C6H12O6Molecular Weight: 186.11 g/molClassification : MedChemExpress Products > Carbohydrates > Monosaccharides > D-mannoseDescription: D-mannose is a research…
Ganoderic acid A
Product Name : Ganoderic acid ASynonym : Chemical Name : CAS NO.: 81907-62-2Molecular formula : C30H44O7Molecular Weight: 516.67 g/molClassification : MedChemExpress Products > Controlled Products > Ganoderic acid ADescription: Ganoderic…
a-Arbutin
Product Name : a-ArbutinSynonym : 4-Hydroxyphenyl-a-D-glucopyranosideChemical Name : CAS NO.: 84380-01-8Molecular formula : C12H16O7Molecular Weight: 272.25 g/molClassification : MedChemExpress Products > Life Sciences > Ligands > Enzyme Modulators > a-ArbutinDescription:…
Ord recall functionality (Table 2). The only outcome that significantly differed amongst
Ord recall functionality (Table 2). The only outcome that significantly differed between the 3 highest doses of each and every drug was that ethanol showed higher decreases than GHB on…
R than two signifies extreme lung injury. AECC=American European Consensus Conference.
R than two signifies severe lung injury. AECC=American European Consensus Conference. PaO2=partial pressure of arterial oxygen. FiO2=fraction of inspired oxygen. PEEP=positive end-expiratory pressure.Table: Definitions of acute respiratory distress syndromecommon danger…
To detect WNK4-HA (Upper) or FLAG to detect KLHL3 (Reduce
To detect WNK4-HA (Upper) or FLAG to detect KLHL3 (Decrease). IP of FLAG-KLHL3 pulls down WNK4.Shibata et al.PNAS | May 7, 2013 | vol. 110 | no. 19 |Healthcare SCIENCESSEE…
Ound a rise in both fecal urease activity and culturable urease
Ound a rise in both fecal urease activity and culturable urease good bacteria in uremic patients.35 Actually, relative increases within the member with the Enterobacteriaceae, Pseudomonadaceae, and Clostridiaceae had been…
Entification of LPS-induced genes that had been regulated by each NF-kB and
Entification of LPS-induced genes that were regulated by both NF-kB and p38. (A) Venn diagram of NF-kB and p38-dependent genes. NF-kB-related genes were identified from genes that have been down-regulated…
Ullan et al. Parasites Vectors 2014, 7:37 http://www.parasitesandvectors/content/7/1/Page 8 ofestimates.
Ullan et al. Parasites Vectors 2014, 7:37 http://www.parasitesandvectors/content/7/1/Page eight ofestimates. Though Yemen was an exception with 62 out there surveys, in general countries in these regions rarely had information from…
Orter NBCe1-A in Xenopus oocytes. J Biol Chem 2006, 281:192419250. 40. Piermarini PM
Orter NBCe1-A in Xenopus oocytes. J Biol Chem 2006, 281:192419250. 40. Piermarini PM, Kim EY, Boron WF: Proof against a direct interaction between intracellular carbonic anhydrase II and pure C-terminal…
Iisothiocyanatostilbene-2,2- disulphonic acid (DIDS)-sensitive (56 to 91 ), and it truly is amiloride-
Iisothiocyanatostilbene-2,2- disulphonic acid (DIDS)-sensitive (56 to 91 ), and it truly is amiloride- and HOE 694-resistant . It is also inhibited by the removal of external Na+ . Relevant molecular…
RO495
Product Name : RO495Synonym : Chemical Name : CAS NO.: 1258296-60-4Molecular formula : C17H14Cl2N6OMolecular Weight: 389.2 g/molClassification : MedChemExpress Products > Research Chemicals > RO495Description: RO495 is a chemotherapeutic agent…
L-Dab·HBr
Product Name : L-Dab·HBrSynonym : Chemical Name : CAS NO.: 1758-80-1Molecular formula : C4H10N2O2·HBrMolecular Weight: 199.05 g/molClassification : MedChemExpress Products > Research Chemicals > L-Dab·HBrDescription: L-Dab·HBr is a diamino butyric…
2′-Deoxy-5′-O-DMT-2′-fluoro-N2-isobutyrylguanosine 3′-CE phosphoramidite
Product Name : 2'-Deoxy-5'-O-DMT-2'-fluoro-N2-isobutyrylguanosine 3'-CE phosphoramiditeSynonym : Chemical Name : CAS NO.: 144089-97-4Molecular formula : C44H53FN7O8PMolecular Weight: 857.91 g/molClassification : MedChemExpress Products > Nucleosides > Phosphoramidites > 2'-Deoxy-5'-O-DMT-2'-fluoro-N2-isobutyrylguanosine 3'-CE phosphoramiditeDescription:…
Nt on several aspects, a major one particular being Shh signaling [40,41]. Growing
Nt on many variables, a significant a single being Shh signaling . Rising concentration with the mild Shh agonist Pur as much as 1 mM enhanced Chx10 expression. Similar results…
PQ (0.25 mg base/kg) plus either artesunate-amodiaquine (AAQ + PQ) or dihydroartemisinin-piperaquine
PQ (0.25 mg base/kg) plus either artesunate-amodiaquine (AAQ + PQ) or dihydroartemisinin-piperaquine (DHP + PQ) for the treatment of uncomplicated monoinfection P. vivax malaria in North Sumatera, Indonesia. Patients had…
Lk in vivo. To understand the mechanism of this defect, numerous
Lk in vivo. To know the mechanism of this defect, many feasible hypotheses had been tested. Lt! r-/- DC were discovered to migrate usually for the draining LN and have…
Tioxidant activity will not be mediated by escalating SOD, CAT and GPx
Tioxidant activity isn't mediated by rising SOD, CAT and GPx activities, but by the down-regulation of iNOS, COX-2, TNF- and IL-6 expression. HO-1 expression is also decreased because AM-EO reduces…
Gths and limitations.The CRMM was built with rigorous internal and
Gths and limitations.The CRMM was built with rigorous internal and external validation of populationbased lung cancer parameters in Canada ahead of 2007; even so, like any model, limitations are inherent…
Tages. 1st, the one-step sample preparation reduces the sample loss and
Tages. First, the one-step sample preparation reduces the sample loss as well as avoids the contamination from the reducing and alkylating reagents. Second, the sample buffer (50 (v/v) ACN and…
Clocinnamox mesylate
Product Name : Clocinnamox mesylateSynonym : Chemical Name : CAS NO.: 117332-69-1Molecular formula : C30H33ClN2O7SMolecular Weight: 601.1 g/molClassification : MedChemExpress Products > Research Chemicals > Clocinnamox mesylateDescription: Clocinnamox mesylate is…
2-Acetyl-4-tetrahydroxybutyl imidazole
Product Name : 2-Acetyl-4-tetrahydroxybutyl imidazoleSynonym : 1--1H-imidazol-2-yl]-ethanone2-ATHBIChemical Name : CAS NO.: 94944-70-4Molecular formula : C9H14N2O5Molecular Weight: 230.22 g/molClassification : MedChemExpress Products > Carbohydrates > Monosaccharides > 2-Acetyl-4-tetrahydroxybutyl imidazoleDescription: Inhibitor of…
Pythidc
Product Name : PythidcSynonym : Chemical Name : CAS NO.: 1821370-71-1Molecular formula : C10H6N2O4SMolecular Weight: 250.23 g/molClassification : MedChemExpress Products > Life Sciences > Ligands > PythidcDescription: Dicarboxylates are a…
Certain band of 500 kDa was located in dASC, aSC and nSC
Precise band of 500 kDa was found in dASC, aSC and nSC, but not in uASC (Figure 3a). Similarly, P2X7 receptor protein (700 kDa) was strongly upregulated in dASC, confirming…
Ncreased hepatic toxicity with investigational chemotherapy was a concern (3), which precluded
Ncreased hepatic toxicity with investigational chemotherapy was a concern (3), which precluded the use of voriconazole orMay 2014 Volume 58 Numberaac.asm.orgGomes et al.TABLE 2 Clinical and treatment-associated risk factors for…
800 A; ten.00.1 min, 30 A; ten.12.0 min, 0 A; 12.02.1 min, 00 A; 12.15.0 min, 90 A. The flow
800 A; ten.00.1 min, 30 A; 10.12.0 min, 0 A; 12.02.1 min, 00 A; 12.15.0 min, 90 A. The flow price was 0.4 ml/min and column temperature was 45 .…
Linical exome sequencing and it will likely be only a matter of
Linical exome sequencing and it will likely be only a matter of time, prior to we'll be confronted with our 1st patient whose exome has been sequenced and whose exome…
That elevated expression of erbB3 confers paclitaxel resistance in erbB2+ breast
That elevated expression of erbB3 confers paclitaxel resistance in erbB2+ breast cancer cells by way of a PI-3K/Akt-dependent mechanism . Because MM-121 primarily inhibits activation of erbB3 and Akt (Figures…
The fungal cellulases and, in certain, from its cellobiohydrolase Cel7a.
The fungal cellulases and, in specific, from its cellobiohydrolase Cel7a. The co-regulation of Cip1 using the other cellulase elements within the fungus, along with the fact that it consists of…
Saikosaponin G
Product Name : Saikosaponin GSynonym : Chemical Name : CAS NO.: 99365-19-2Molecular formula : C42H68O13Molecular Weight: 780.99 g/molClassification : MedChemExpress Products > Natural Products > Saikosaponin GDescription: Saikosaponin G is…
2,6-Dimethoxybenzaldehyde
Product Name : 2,6-DimethoxybenzaldehydeSynonym : Chemical Name : CAS NO.: 3392-97-0Molecular formula : C9H10O3Molecular Weight: 166.17 g/molClassification : MedChemExpress Products > Research Chemicals > Building Blocks > Benzaldehydes > 2,6-DimethoxybenzaldehydeDescription:…
Fmoc-beta-cyclohexyl-D-alanine
Product Name : Fmoc-beta-cyclohexyl-D-alanineSynonym : Fmoc-D-Cha-OHFmoc-3-cyclohexyl-D-alanineChemical Name : CAS NO.: 144701-25-7Molecular formula : C24H27NO4Molecular Weight: 393.48 g/molClassification : MedChemExpress Products > Research Chemicals > Fmoc-beta-cyclohexyl-D-alanineDescription: Fmoc-beta-cyclohexyl-D-alanine is a fragment of…
Eptor. This latterprocess accounts for the previously observed delayed muscarine-induced enhancement
Eptor. This latterprocess accounts for the previously observed delayed muscarine-induced enhancement of neurotransmitter release (Graves et al. 2004).The identity, localization and regulation of COX-2 at the NMJCyclooxygenase exists in at…
Constant for HA-HARE complexes in cells expressing recombinant hHARE (Kd 7 nM
Constant for HA-HARE complexes in cells expressing recombinant hHARE (Kd 7 nM) or purified ectodomain (Kd ten 0 nM). HARE is really a constitutively recycling receptor that functions within the…
Bubbles within a chosen area with the field soon after 15 min stimulation
Bubbles in a selected location in the field soon after 15 min stimulation with MCh; ideal column (B, D, F, H, J) shows C-sweat (or lack of it) in corresponding…
F HuR was connected with lymph node metastasis in non-small cell
F HuR was linked with lymph node metastasis in non-small cell lungInt. J. Mol. Sci. 2013,carcinoma , colon carcinoma , upper urinary tract urothelial carcinoma , and showed a correlation…
42]. Association of GLUT-1 with stomatin was shown to decrease glucose uptake
42]. Association of GLUT-1 with stomatin was shown to reduce glucose uptake and enhance DHA uptake . Even though we didn't investigate any mechanistic background we also observed that M1…
Ictated by the researchers, plus the participants have been “enforced” to perform
Ictated by the researchers, as well as the participants have been ``enforced'' to execute a continuous PO at 105 above the imply PO until the finish with the second kilometer.…
Cells. (E) Immunofluorescence for -tubulin in wild kind, cingulin KD cells
Cells. (E) Immunofluorescence for -tubulin in wild sort, cingulin KD cells, and KD cells expressing an exogenous RNAi-resistant cingulin sequence (cingulin revertant Rev.). Bar, 5 . The relative signal intensity…
Sitive Predictive ValueFigure 4 Sensitivity versus PPV. Sensitivity vs optimistic predictive worth
Sitive Predictive ValueFigure 4 Sensitivity versus PPV. Sensitivity vs good predictive value (PPV) for diverse prediction algorithms; for AveRNA, the points along the curve have been obtained by adjusting the…
4,5,6,7-Tetrahydrothieno[3,2-c]pyridine hydrochloride
Product Name : 4,5,6,7-Tetrahydrothienopyridine hydrochlorideSynonym : 4,5,6,7-Tetrahydrothienopyridine hydrochloride6,7-Dihydro-4H-thienopyridine hydrochlorideChemical Name : CAS NO.: 28783-41-7Molecular formula : C7H10ClNSMolecular Weight: 175.68 g/molClassification : MedChemExpress Products > Research Chemicals > 4,5,6,7-Tetrahydrothienopyridine hydrochlorideDescription: Tetrahydrothienopyridine…
Phosphoramide mustard
Product Name : Phosphoramide mustardSynonym : Chemical Name : CAS NO.: 10159-53-2Molecular formula : C4H11Cl2N2O2PMolecular Weight: 221.02 g/molClassification : MedChemExpress Products > Research Chemicals > Phosphoramide mustardDescription: Phosphoramide mustard is…
3-(N-Tosyl-L-alaninyloxy)-5-phenylpyrrole
Product Name : 3-(N-Tosyl-L-alaninyloxy)-5-phenylpyrroleSynonym : Chemical Name : CAS NO.: 99740-00-8Molecular formula : C20H20N2O4SMolecular Weight: 384.45 g/molClassification : MedChemExpress Products > Research Chemicals > 3-(N-Tosyl-L-alaninyloxy)-5-phenylpyrroleDescription: 3-(N-Tosyl-L-alaninyloxy)-5-phenylpyrrole is a chiral, enantiomeric…
Probable that a number of the variations in the outcomes amongst studies
Achievable that a few of the variations within the final results among studies, like NaCl infusion eliciting Fos inside the DL subdivision on the PBN (Yamamoto et al. 1994), are…
Power image further showed COX2 mRNA expression was mostly located in
Energy image additional showed COX2 mRNA expression was mostly situated inside the renal medullary interstitium between renal tubules (Figure 1c, F). In contrast to COX2, high levels of COX1 mRNA…
Ted in a six-well plate in the similar concentration as that
Ted inside a six-well plate in the exact same concentration as that for the osteogenic assay. The cells were cultured inside the complete culture medium for three days, and were…
Owders showed crystalline peaks only for ciprofloxacin hydrochloride [Figure 3]. Ciprofloxacin hydrochloride
Owders showed crystalline peaks only for ciprofloxacin hydrochloride . Ciprofloxacin hydrochloride was thus within the crystalline state when gentamicin sulfate was in amorphous state. Furthermore, the DRX spectra in the…
Sec for PJ34 TBI and 59.61 ten.12 sec for vehicle TBI groups. A
Sec for PJ34 TBI and 59.61 ten.12 sec for car TBI groups. A probe trial was performed on PID 18. One-way ANOVA followed by Student Newman-Keuls post-hoc evaluation indicated that…
Ng.36,37 Equivalent to Ratajczak, et al.’s study, we identified that
Ng.36,37 Related to Ratajczak, et al.'s study, we found that the formation of biofilm is substantially stronger in MDR isolates, and 64.7 (11 out of 17 isolates) of robust biofilm…
Of endothelial cells may induce modifications of these cells, resulting in
Of endothelial cells may well induce modifications of those cells, resulting in invasion on the CNS. Bloodstream spread is definitely an significant step in the pathogenesis of quite a few…
Llele names (12). A functioning group was convened in 2010 for the goal
Llele names (12). A working group was convened in 2010 for the purpose of reviewing and updating the CWD catalogue; where the original catalogue was the solution of an ASHI…
Enduracidin hydrochloride
Product Name : Enduracidin hydrochlorideSynonym : Chemical Name : CAS NO.: 11115-82-5Molecular formula : C107H138Cl2N26O31HClMolecular Weight: 2,391.76 g/molClassification : MedChemExpress Products > Antimicrobials > Antibiotics > Enduracidin hydrochlorideDescription: Enduracidin is…
(R)-Amino carnitine
Product Name : (R)-Amino carnitineSynonym : (2R)-2-Amino-3-carboxy-N,N,N-trimethyl-1-propanaminium inner salt(R)-3-Amino-4-(trimethylammonio)butyrateEmeriamineChemical Name : CAS NO.: 98063-21-9Molecular formula : C7H16N2O2Molecular Weight: 160.21 g/molClassification : MedChemExpress Products > Research Chemicals >Fine Chemicals > (R)-Amino…
3-Propoxypropane-1,2-diol
Product Name : 3-Propoxypropane-1,2-diolSynonym : Chemical Name : CAS NO.: 61940-71-4Molecular formula : C6H14O3Molecular Weight: 134.17 g/molClassification : MedChemExpress Products > Research Chemicals > 3-Propoxypropane-1,2-diolDescription: 3-Propoxypropane-1,2-diol is a surfactant that…
Damnacanthal
Product Name : DamnacanthalSynonym : Chemical Name : CAS NO.: 477-84-9Molecular formula : C16H10O5Molecular Weight: 282.25 g/molClassification : MedChemExpress Products > Research Chemicals > DamnacanthalDescription: Damnacanthal is a natural compound…
DO34 analog
Product Name : DO34 analogSynonym : Chemical Name : CAS NO.: 2098969-71-0Molecular formula : C26H28F3N5O4Molecular Weight: 531.5 g/molClassification : MedChemExpress Products > Life Sciences > Ligands > DO34 analogDescription: DO34…
Caesalpine A
Product Name : Caesalpine ASynonym : Chemical Name : CAS NO.: 1616757-59-5Molecular formula : C23H32O7Molecular Weight: 420.50 g/molClassification : MedChemExpress Products > Natural Products > Caesalpine ADescription: Caesalpine A is…
Delafloxacin – Bio-X ™
Product Name : Delafloxacin - Bio-X ™Synonym : 1-(6-Amino-3,5-difluoropyridin-2-yl)-8-chloro-6-fluoro-7-(3-hydroxyazetidin-1-yl)-4-oxo-1,4-dihydroquinoline-3-carboxylic acidChemical Name : CAS NO.: 189279-58-1Molecular formula : C18H12ClF3N4O4Molecular Weight: 440.76 g/molClassification : MedChemExpress Products > Antimicrobials > Delafloxacin - Bio-X…
Mephenytoin
Product Name : MephenytoinSynonym : Chemical Name : CAS NO.: 50-12-4Molecular formula : C12H14N2O2Molecular Weight: 218.25 g/molClassification : MedChemExpress Products > Research Chemicals > MephenytoinDescription: Mephenytoin is a drug that…
Nerolidol (cis/trans)
Product Name : Nerolidol (cis/trans)Synonym : 3-Hydroxy-3,7,11-trimethyl-1,6,10-dodecatriene3,7,11-Trimethyl-1,6,10-dodecatrien-3-olChemical Name : CAS NO.: 7212-44-4Molecular formula : C15H26OMolecular Weight: 222.37 g/molClassification : MedChemExpress Products > Natural Products > Terpenes > Nerolidol (cis/trans)Description: Nerolidol…
Alloyohimbine
Product Name : AlloyohimbineSynonym : Chemical Name : CAS NO.: 522-94-1Molecular formula : C21H26N2O3Molecular Weight: 354.4 g/molClassification : MedChemExpress Products > Natural Products > AlloyohimbineDescription: Alloyohimbine is a natural product…
AS 2521780
Product Name : AS 2521780Synonym : Chemical Name : CAS NO.: 1214726-89-2Molecular formula : C30H41N7OSMolecular Weight: 547.8 g/molClassification : MedChemExpress Products > Life Sciences > AS 2521780Description: AS 2521780 is…
Berubicin hydrochloride
Product Name : Berubicin hydrochlorideSynonym : Chemical Name : CAS NO.: 293736-67-1Molecular formula : C34H36ClNO11Molecular Weight: 670.1 g/molClassification : MedChemExpress Products > Life Sciences > Berubicin hydrochlorideDescription: Berubicin hydrochloride is…
Iristectorigenin A
Product Name : Iristectorigenin ASynonym : Chemical Name : CAS NO.: 39012-01-6Molecular formula : C17H14O7Molecular Weight: 330.29 g/molClassification : MedChemExpress Products > Natural Products > Iristectorigenin ADescription: Iristectorigenin A is…
Methyltetrazine-PEG4-azide
Product Name : Methyltetrazine-PEG4-azideSynonym : Chemical Name : CAS NO.: 1802908-04-8Molecular formula : C17H23N7O4Molecular Weight: 389.4 g/molClassification : MedChemExpress Products > PEG Polymers > Methyltetrazine-PEG4-azideDescription: Methyltetrazine-PEG4-azide is a compound that…
Bonvalotidine A
Product Name : Bonvalotidine ASynonym : Chemical Name : CAS NO.: 929019-25-0Molecular formula : Molecular Weight: Classification : MedChemExpress Products > Research Chemicals > Bonvalotidine ADescription: Bonvalotidine A is a…
Revefenacin
Product Name : RevefenacinSynonym : Chemical Name : CAS NO.: 864750-70-9Molecular formula : Molecular Weight: Classification : MedChemExpress Products > Research Chemicals > RevefenacinDescription: Revefenacin is a long-acting anticholinergic agent…
3,3′-Dithiobispropionic acid bis-sulfosuccinimidyl ester
Product Name : 3,3'-Dithiobispropionic acid bis-sulfosuccinimidyl esterSynonym : 3,3'-Dithiobis(sulfosuccinimidyl propionate)DTSSPChemical Name : CAS NO.: 81069-02-5Molecular formula : C14H16N2O14S4Molecular Weight: 564.55 g/molClassification : MedChemExpress Products > Research Chemicals > 3,3'-Dithiobispropionic acid…
Febuxostat
Product Name : FebuxostatSynonym : 2--4-methyl-5-thiazolecarboxylic acidChemical Name : CAS NO.: 144060-53-7Molecular formula : C16H16N2O3SMolecular Weight: 316.38 g/molClassification : MedChemExpress Products > Research Chemicals > FebuxostatDescription: Non-purine inhibitor of xanthine…
1-O-(2R)-Glycerol-b-D-galactopyranoside
Product Name : 1-O-(2R)-Glycerol-b-D-galactopyranosideSynonym : RGG(2R)-2,3-Dihydroxypropyl b-D-galactopyranosideChemical Name : CAS NO.: 16232-91-0Molecular formula : C9H18O8Molecular Weight: 254.23 g/molClassification : MedChemExpress Products > Carbohydrates > Monosaccharides > 1-O-(2R)-Glycerol-b-D-galactopyranosideDescription: 1-O-(2R)-Glycerol-b-D-galactopyranoside is a…
Lactiflorin
Product Name : LactiflorinSynonym : Chemical Name : CAS NO.: 1361049-59-3Molecular formula : C23H26O10Molecular Weight: 462.4 g/molClassification : MedChemExpress Products > Impurities > LactiflorinDescription: Lactiflorin is a natural compound that…
7-Acetylintermedine
Product Name : 7-AcetylintermedineSynonym : (1R-(1alpha,7(2S*,3R*),7abeta))-2,3-Dihydroxy-2-(1-Methylethyl)-Butanoic Acid (1-(Acetyloxy)-2,3,5,7a-Tetrahydro-1H-Pyrrolizin-7-Yl) Methyl EsterChemical Name : CAS NO.: 74243-01-9Molecular formula : C17H27NO6Molecular Weight: 341.4 g/molClassification : MedChemExpress Products > Research Chemicals >Fine Chemicals >…
(+/-)-N-Cyano-N’-4-pyridinyl-N’-(1,2,2-trimethylpropyl)guanidine monohydrate
Product Name : (+/-)-N-Cyano-N'-4-pyridinyl-N'-(1,2,2-trimethylpropyl)guanidine monohydrateSynonym : Pinacidil monohydrateChemical Name : CAS NO.: 85371-64-8Molecular formula : C13H19N5·H2OMolecular Weight: 263.34 g/molClassification : MedChemExpress Products > Research Chemicals > (+/-)-N-Cyano-N'-4-pyridinyl-N'-(1,2,2-trimethylpropyl)guanidine monohydrateDescription: (+/-)-N-Cyano-N'-4-pyridinyl-N'-(1,2,2-trimethylpropyl)guanidine monohydrate…
Dequalinium chloride
Product Name : Dequalinium chlorideSynonym : Chemical Name : CAS NO.: 522-51-0Molecular formula : C30H40Cl2N4Molecular Weight: 527.57 g/molClassification : MedChemExpress Products > Antimicrobials > Antibiotics > Dequalinium chlorideDescription: Dequalinium chloride…
A 922500
Product Name : A 922500Synonym : Chemical Name : CAS NO.: 959122-11-3Molecular formula : C26H24N2O4Molecular Weight: 428.48 g/molClassification : MedChemExpress Products > Life Sciences > Ligands > Enzyme Modulators >…
3-Methoxymollugin
Product Name : 3-MethoxymolluginSynonym : Chemical Name : CAS NO.: 154706-44-2Molecular formula : C18H18O5Molecular Weight: 314.3 g/molClassification : MedChemExpress Products > Research Chemicals > 3-MethoxymolluginDescription: 3-Methoxymollugin is a natural product…
Ningetinib
Product Name : NingetinibSynonym : Chemical Name : CAS NO.: 1394820-69-9Molecular formula : C31H29FN4O5Molecular Weight: 556.58 g/molClassification : MedChemExpress Products > Life Sciences > NingetinibDescription: Tyrosine kinase inhibitorPurity : >98%Specifications…
Anemarsaponin B
Product Name : Anemarsaponin BSynonym : Chemical Name : CAS NO.: 139051-27-7Molecular formula : C45H74O18Molecular Weight: 903.06 g/molClassification : MedChemExpress Products > Research Chemicals >Fine Chemicals > Anemarsaponin BDescription: Anemarsaponin…
Nicardipine
Product Name : NicardipineSynonym : Chemical Name : CAS NO.: 55985-32-5Molecular formula : C26H29N3O6Molecular Weight: 479.53 g/molClassification : MedChemExpress Products > Research Chemicals > NicardipineDescription: L-type calcium channel blockerPurity :…
Ziltivekimab
Product Name : ZiltivekimabSynonym : Chemical Name : CAS NO.: 2226654-05-1Molecular formula : Molecular Weight: Classification : MedChemExpress Products > Life Sciences > Antibodies > Monoclonal Antibodies > ZiltivekimabDescription: Anti-Interleukin…
Glycochenodeoxycholic acid
Product Name : Glycochenodeoxycholic acidSynonym : N-(3alpha,7alpha-Dihydroxy-24-oxocholan-24-yl)glycine 3alpha,7alpha-Dihydroxy-5beta-cholanoic acid N-(carboxymethyl)amideChemical Name : CAS NO.: 640-79-9Molecular formula : C26H43NO5Molecular Weight: 449.64 g/molClassification : MedChemExpress Products > Research Chemicals > Glycochenodeoxycholic acidDescription:…
Tetrabutylammonium Dichlorobromide
Product Name : Tetrabutylammonium DichlorobromideSynonym : Chemical Name : CAS NO.: 13053-75-3Molecular formula : C16H36BrCl2NMolecular Weight: 393.28 g/molClassification : MedChemExpress Products > Research Chemicals > Tetrabutylammonium DichlorobromideDescription: Tetrabutylammonium Dichlorobromide is…
Fostriecin sodium salt
Product Name : Fostriecin sodium saltSynonym : Chemical Name : CAS NO.: 87860-39-7Molecular formula : C19H26O9PNaMolecular Weight: 452.37 g/molClassification : MedChemExpress Products > Research Chemicals > Fostriecin sodium saltDescription: Fostriecin…
Ponceau 3R
Product Name : Ponceau 3RSynonym : Food red 6,disodium saltChemical Name : CAS NO.: 3564-09-8Molecular formula : C19H16N2Na2O7S2Molecular Weight: 494.45 g/molClassification : MedChemExpress Products > Research Chemicals > Ponceau 3RDescription:…
H2N-PEG11-CH2CH2COOH
Product Name : H2N-PEG11-CH2CH2COOHSynonym : Chemical Name : CAS NO.: 1616426-12-0Molecular formula : C25H51NO13Molecular Weight: 573.7 g/molClassification : MedChemExpress Products > PEG Polymers > H2N-PEG11-CH2CH2COOHDescription: H2N-PEG11-CH2CH2COOH is a heterobifunctional PEG…
GDC-0349
Product Name : GDC-0349Synonym : Chemical Name : CAS NO.: 1207360-89-1Molecular formula : C24H32N6O3Molecular Weight: 452.55 g/molClassification : MedChemExpress Products > Research Chemicals > GDC-0349Description: GDC-0349 is a drug that…
Pterodontic acid
Product Name : Pterodontic acidSynonym : Chemical Name : CAS NO.: 185845-89-0Molecular formula : Molecular Weight: Classification : MedChemExpress Products > Research Chemicals > Pterodontic acidDescription: Pterodontic acid is a…
Fmoc-N-methyl-L-alanine
Product Name : Fmoc-N-methyl-L-alanineSynonym : Fmoc-N-Me-L-Ala-OHChemical Name : CAS NO.: 84000-07-7Molecular formula : C19H19NO4Molecular Weight: 325.36 g/molClassification : MedChemExpress Products > Research Chemicals > Fmoc-N-methyl-L-alanineDescription: Fmoc-N-methyl-L-alanine is a marine sponge…
Boc-S-benzyl-L-cysteine
Product Name : Boc-S-benzyl-L-cysteineSynonym : Boc-L-Cys(Bzl)-OHChemical Name : CAS NO.: 5068-28-0Molecular formula : C15H21NO4SMolecular Weight: 311.4 g/molClassification : MedChemExpress Products > Research Chemicals > Boc-S-benzyl-L-cysteineDescription: Boc-S-benzyl-L-cysteine is a model protein…
Oprozomib
Product Name : OprozomibSynonym : Chemical Name : CAS NO.: 935888-69-0Molecular formula : C25H32N4O7SMolecular Weight: 532.61 g/molClassification : MedChemExpress Products > Life Sciences > Ligands > Enzyme Modulators > OprozomibDescription:…
(2S)-Butan-2-yl2-(3-[4-[2-(diethylamino)ethoxy]-3,5-diiodobenzoyl]-1-benzofuran-2-yl)acetate
Product Name : (2S)-Butan-2-yl2-(3--3,5-diiodobenzoyl]-1-benzofuran-2-yl)acetateSynonym : Chemical Name : CAS NO.: 335148-45-3Molecular formula : C27H31I2NO5Molecular Weight: 703.35 g/molClassification : MedChemExpress Products > Controlled Products > (2S)-Butan-2-yl2-(3--3,5-diiodobenzoyl]-1-benzofuran-2-yl)acetateDescription: (2S)-Butan-2-yl2-(3--3,5-diiodobenzoyl]-1-benzofuran-2-yl)acetate is a nonselective cation…
L-Valine benzyl ester hydrochloride
Product Name : L-Valine benzyl ester hydrochlorideSynonym : L-Val-OBzl·HClChemical Name : CAS NO.: 2462-34-2Molecular formula : C12H17NO2·HClMolecular Weight: 243.73 g/molClassification : MedChemExpress Products > Research Chemicals > L-Valine benzyl ester…
N-Acetyltyramine
Product Name : N-AcetyltyramineSynonym : Chemical Name : CAS NO.: 1202-66-0Molecular formula : C10H13NO2Molecular Weight: 179.22 g/molClassification : MedChemExpress Products > Research Chemicals > N-AcetyltyramineDescription: N-Acetyltyramine is an amine that…
Optotic activity [39]. Our PCRMolecular Vision 2013; 19:2011-2022 http://www.molvis.org/molvis
Optotic activity . Our PCRMolecular Vision 2013; 19:2011-2022 http://www.molvis.org/molvis/v19/20112013 Molecular VisionFigure 4. Immunohistochemistry for inhibitor of apoptosis 1, the retinal ganglion cell marker Thy 1, glial fibrillary acidic protein, and…
Carotenoid and tocochromanol biosynthesis more than blue and red lights. The induction
Carotenoid and tocochromanol biosynthesis over blue and red lights. The induction effect of blue light on carotenoid and tocochromanolbiosynthesis was superior to that of red light, which has guiding significance…
Hat mammalian genomes are organized into topological domains, the boundaries of
Hat mammalian genomes are organized into topological domains, the boundaries of which show enrichment for SINEs and CTCF binding, and where the spread of heterochromatin is constrained (Dixon et al.…
S (SINE) and long-terminal repeat (LTR)TEs, making use of the HOMER bioinformatic
S (SINE) and long-terminal repeat (LTR)TEs, utilizing the HOMER bioinformatic package (http://biowhat.ucsd. edu/homer/motif). Sequences analyzed corresponded to those that were present in C57BL/6 but absent in A/J (known as C57…
Atory response in hORMDL3zp3-Cre mice had evidence of both
Atory response in hORMDL3zp3-Cre mice had evidence of each Th2 mediated inflammation (improved CD4+ cells and eosinophils), too as enhanced neutrophils and macrophages we investigated whether their lungs expressed cytokines…
Ng from 50 mM to1 mM for two, four, six, and ten
Ng from 50 mM to1 mM for two, 4, six, and ten hours. The assay was performed beneath regular development situations along with the effect of oxidative insult on cell…
Is often compared with all the proportion of resistance mutations in which
Could be compared with all the proportion of resistance mutations in which non-synonymous SNVs are observed within the MSA. If non-synonymous SNVs that lead to resistant mutations are subject only…
Nt distinction ( p 0.05) among HA-FIB constructs and bevacizumab-containing constructs HA-FIB-B3.75 and
Nt difference ( p 0.05) in between HA-FIB constructs and bevacizumab-containing constructs HA-FIB-B3.75 and HAFIB-B5 (Fig. 5D). These observations matched together with the benefits of the histological scoring. Statistically substantial…
Xidation (Sorokin et al., 2003). A selection of half-saturation constants, 11.four 42 mM NO
Xidation (Sorokin et al., 2003). A range of half-saturation constants, 11.4 42 mM NO3 (0.16 NO3 -N), had been utilized for the heterotrophic two mg l pathway-based values from the…
Om Ibsen, non-financial help from CellMedica, non-financial help from MSD, other
Om Ibsen, non-financial help from CellMedica, non-financial help from MSD, other from Boehringer Ingelheim, outdoors the submitted work. Dr. Lindsay has received institutional as a internet site PI for any…
Publications have been integrated for overview.Clinical Interventions in Aging 2014:submit your
Publications have been integrated for assessment.Clinical Interventions in Aging 2014:submit your manuscript | www.dovepressDovepressFujiwara et alDovepressPubMed n=Embase n=223 Duplicates, n=Total publications for critique n=Excluded, n=201 Not human, n=10 Not low…
Award for Healthcare Scientists. The isolation and evaluation of lipid A
Award for Health-related Scientists. The isolation and evaluation of lipid A was supported in element by a Department of Energy grant, DE-FG-0293ER20097, towards the Complicated Carbohydrate Analysis Center. The content…
Ver, at four months of infection mice immunized with alum + LAg and
Ver, at four months of infection mice immunized with alum + LAg and saponin + LAg showed minimal differences in DTH response as compared with PBS too as cost-free adjuvant-immunized…
E different from these of B27(309 20). In contrast, the only main
E unique from those of B27(309 20). In contrast, the only significant cluster in DNAP(21123) showed a striking similarity to B27(309 20), hunting like an intermediate form of rep2 and…
Porter-2 (SGLT-2) inhibitor: characterisation and comparison with other SGLT-2 inhibitors. Diabetes
Porter-2 (SGLT-2) inhibitor: characterisation and comparison with other SGLT-2 inhibitors. Diabetes Obes Metab 2012, 14:830. ten. Seman L, Macha S, Nehmiz G, Simons G, Ren B, Pinnetti S, Woerle HJ,…
Lity of Ficoll to help cell survival has to do with
Lity of Ficoll to assistance cell survival has to complete with properties popular to each the Ficoll and sucrose formulation, e.g. the amorphous structure. Focusing on the polymers, it is…
Lammatory cytokine genes are usually not among the named genes (Kaltschmidt et
Lammatory cytokine genes will not be amongst the named genes (Kaltschmidt et al., 2002, Kassed et al., 2004, Kaltschmidt et al., 2006, Boersma et al., 2011, Schmeisser et al., 2012).…
Erol, sesamin, sesamolin, and sesamol.13 Ahmad et al7 reported the anti-oxidative
Erol, sesamin, sesamolin, and sesamol.13 Ahmad et al7 reported the anti-oxidative home of sesame oil in 6-hydroxydopamine induced neurotoxicity. Karatzi et al14 reported that the valuable effect of everyday intake…
Individuals (Craner et al., 2004). The mechanisms accountable for disruption of nodal
Individuals (Craner et al., 2004). The mechanisms accountable for disruption of nodal sodium channels in MS are certainly not properly understood. Interestingly, autoantibodies against Nfasc have been found in MS…
Nds with His 134 and Gly 143 (Figure 11). Additionally, the phenyltriazole part
Nds with His 134 and Gly 143 (Figure 11). Furthermore, the phenyltriazole part of the inhibitor snugly fits the catalytic site. The phenyltriazole group of T247 lies within the hydrophobic…
Ched healthful handle (reduce). The total ion chromatograms (TICs) exhibited the
Ched healthy control (reduced). The total ion chromatograms (TICs) exhibited the ideal separation outcome below the optimized gradient elution process and plasma metabolomic profile for each and every sample, which…
Ot as a consequence of other causes but could be the illness per se
Ot due to other causes but may be the illness per se) or secondary (i.e., the symptom of one more situation)2. In 80 of cases, the chronic headache is really…
, 10 had been further confirmed as lacking in GlaI inhibition and 9 were confirmed
, 10 have been further confirmed as lacking in GlaI inhibition and 9 have been confirmed for their ability to inhibit within the presence of detergent. These secondary and confirmatory…
Recent admission linked with greater odds of prasugrel use. Escalating age
Recent admission connected with higher odds of prasugrel use. Growing age more than age 75, prior stroke, and reduced physique weight beneath 80 kg were connected with reduce odds of…
Ral assays, such as the numbers of physique bends, head thrashes, and
Ral assays, like the numbers of physique bends, head thrashes, and the reversal frequency are effectively established protocols for studying neuronal circuits that handle behaviors . To test regardless of…
On-linear regression evaluation. The outcomes are presented as the percentage of
On-linear regression analysis. The results are presented as the percentage of kinase activity relative towards the DMSO-treated manage. Results are signifies + S.D. for triplicate reactions with equivalent results obtained…
05 0.39/0.97 1.01/0.83 1.26/0.65 0.65/1.04 1.10/0.47 0.14/0.99 0.91/1.16 1.26/0.39 1.25/2.12 0.28/1.06 1.26/0.64 1.30/2.26 1.32/0.30 1.32/0.52 1.27/1.25 1.17/0.72 0.91/1.23 0.66/0.87 1.03/1.13 0.82/1.11 0.34/1.1.28/2.37 1.27/0.48 1.30/0.33 0.63/0.92 1.27/0.41 1.17/0.80 1.17/0.76 0.46/1.08 0.24/1.04 0.84/1.06 0.52/1.10 0.10/1.00 0.21/1.03 1.30/0.27 1.13/0.75 1.30/1.70 1.29/0.30 1.06/1.31 1.27/2.01 1.00/0.85 1.31/3.65 1.22/0.75 0.58/1.11 1.26/1.78 1.24/1.33 1.30/2.46 0.11/0.97 0.93/1.22 0.66/1.09 0.69/1.and significant differentially expressed genes had been examined. As shown in Figure
05 0.39/0.97 1.01/0.83 1.26/0.65 0.65/1.04 1.10/0.47 0.14/0.99 0.91/1.16 1.26/0.39 1.25/2.12 0.28/1.06 1.26/0.64 1.30/2.26 1.32/0.30 1.32/0.52 1.27/1.25 1.17/0.72 0.91/1.23 0.66/0.87 1.03/1.13 0.82/1.11 0.34/1.1.28/2.37 1.27/0.48 1.30/0.33 0.63/0.92 1.27/0.41 1.17/0.80 1.17/0.76 0.46/1.08 0.24/1.04…
E zooplankton exoskeleton chitin serves as a carbon supply for the
E zooplankton exoskeleton chitin serves as a carbon source for the pathogen (Colwell and Huq, 2001). In linking outbreaks of your coral disease atramentous necrosis to terrestrial runoff around the…
Elial carcinoma with the bladder (UCB) would be the most common histological
Elial carcinoma of your bladder (UCB) is definitely the most typical histological subtype of bladder cancer. General, 70 of bladder tumors present as noninvasive urothelial carcinoma (UC), and* Correspondence: [email protected];…
Ext, portions on the N and C termini have been added, and
Ext, portions of the N and C termini were added, and conformations of every single had been refined in Modeler. The termini were minimized making use of stages 4 to…
Nd plasma was collected and stored at -80 until evaluation. Oral
Nd plasma was collected and stored at -80 till analysis. Oral Dosing for F determination: Compound was dosed by oral gavage (10 mg/ kg) as a suspension of 1 mg/mL…
C). Previous experiments in which AID/APOBEC deaminases have been applied
C). Prior experiments in which AID/APOBEC deaminases have been used to mutate certain bacterial or retroviral gene targets have revealed that person deaminases show characteristic flanking nucleotide preferences. On the…
NanR binds the nanE promoter within a related manner, as shown
NanR binds the nanE promoter within a related manner, as shown by the appearance in the upper band (Shift). Unbound nanE promoter probe (PnanA) and nonspecific probe (Non-Sp) are also…
A earlier study showed that the selective H3 receptor agonist R-alphamethylhistamine
A prior study showed that the selective H3 receptor agonist R-alphamethylhistamine did not cause modifications in lymphatic pumping . Third, the currently available anti-H4 receptor antibodies have been shown to…
Tte (aacC1) gene carries a 70 dependent promoter. The arrow pointing leftward
Tte (aacC1) gene carries a 70 dependent promoter. The arrow pointing leftward corresponds towards the position of primer seq 1 made use of for mapping the P1 start website.AlgU is…
Outside the synapse may possibly nevertheless let exchange of receptors among compartments.
Outdoors the synapse could nonetheless enable exchange of receptors amongst compartments. To prevent this, we immobilized surface AMPARs by cross-linking . Cross-linking of GluA1containing receptors with antibodies ahead of (X-link)…
Tion c.-22TC c.51119 51118delTG c.1009CT c.1128+3GA c.
Tion c.-22TC c.51119 51118delTG c.1009CT c.1128+3GA c.1590+31AT c.1684+23GA c.1685-43GA c.1795-18CT c.1860CT c.1945GA c.+2285CT c.+2976GA Amino acid transform -- -- A336A -- -- -- -- -- H620H D649N -- -- Frequency…
Ucture (7) as a search model and subsequently refined to a resolution
Ucture (7) as a search model and subsequently refined to a resolution of two.0 for the native fragment and two.1 for the crystals soaked in ManNAc (Table 1). The crystal…
Even at pretty higher concentrations (Table four). Thus, conjugation of indomethacin with
Even at pretty high concentrations (Table four). Hence, conjugation of indomethacin using a zwitterionic fluorophore tethered through an n-butyldiamide linker is most appropriate to achieve COX-2 inhibitory activity. Highly polar…
Nonetheless, further studies are required to elucidate the mechanistic basis of
Having said that, further studies are necessary to elucidate the mechanistic basis of induction with the pmr and arn genes by low levels of c-diGMP. The reported induced resistance thus…
57). GCK-3 induces significant modifications in MTS reagent reactivity at amino acid
57). GCK-3 induces substantial alterations in MTS reagent reactivity at amino acid residues associated with all the subunit interface (Table 1 and Figs. four and five). Conformational alterations in the…
Allization robot (TTP Labtech, UK). Rod-shaped crystals grew at space temperature
Allization robot (TTP Labtech, UK). Rod-shaped crystals grew at space temperature in 1 week making use of a properly answer containing 20 polyethylene glycol (PEG) 3350 and 0.1 M potassium…
IEPA; n = 1). At 48 h after IR, the amount of ROS was
IEPA; n = 1). At 48 h soon after IR, the level of ROS was still enhanced 1.6-fold (FaDu) and two.2-fold (A172) but not impacted by IEPA any longer (Figure…
Ays post infection. a) Animals raised on different food sources directly.
Ays post infection. a) Animals raised on diverse meals sources straight. b) Animals raised exclusively on S. obliquus, but mothers raised on diverse meals sources. Information are indicates of n…
8). By way of example, inside the rodent visual cortex the developmental switch from
eight). For example, inside the rodent visual cortex the developmental switch from GluN2B to GluN2A is delayed by extended dark-rearing (Quinlan et al., 1999).Recent evidence has shown that the availability…
Much more, we identified that stress-regulated genes (KIN2, RD29A and RD
Much more, we located that stress-regulated genes (KIN2, RD29A and RD29B) within the cyp709b3 mutant had been not substantially altered in comparison with wild kind. DREB1A and ERD10 expression was…
Ere mainly decreased or unaffected by the remedy. When compared with RARc
Ere mostly decreased or unaffected by the therapy. In comparison with RARc ligand application, expression of those genes was markedly downregulated (a number of times below detection limit) when mice…
, mutant cells had to cope having a low intracellular power state
, mutant cells had to cope with a low intracellular energy state, which correlates to some extent using a wild variety increasing on elemental sulfur, reflected each by pyrophosphate and…
Total of MPN samples, and this quantity was employed as a
Total of MPN samples, and this quantity was utilized as a denominator to determine the frequency of JAK2V617F-positive circumstances inside the cohort.RESULTSFrom the 78 analysed samples, 50 (64 ) have…
-a contents had been quantified having a cytotoxicity assay involving L929 cells
-a contents were quantified having a cytotoxicity assay involving L929 cells (an actinomycin D-treated murine fibroblast cell line) using rmTNF-a as the standard as described by Kerekgyarto et al. .…
Ds have been converted to fatty acid methyl esters in order that they
Ds were converted to fatty acid methyl esters in order that they may very well be separated by gas chromatography. Tsc2 p53MEFs were cultured beneath S or SO situations with…
Isabil Res 1994, 38(Pt 3):26573. Pritchard MA, Kola I: The “gene dosage effect
Isabil Res 1994, 38(Pt 3):26573. Pritchard MA, Kola I: The "gene dosage effect" hypothesis versus the "amplified developmental instability" hypothesis in Down syndrome. J Neural Transm Suppl 1999, 57:29303. Delabar…
Myeloid precursors was not correlated together with the illness prognosis or response
Myeloid precursors was not correlated with all the disease prognosis or response to therapy, suggesting that in such cell compartments the influence of Cby1 expression on beta catenin signaling could…
A 15 final reaction volume utilizing 1 iQTM SYBRGreen Supermix (Bio-Rad), and 500 nM
A 15 final reaction volume applying 1 iQTM SYBRGreen Supermix (Bio-Rad), and 500 nM genespecific primers, which were designed based on the respective GenBank sequence for the examined gene. Amplifications…
Have been obtained from 5 untreated sufferers For detection of activated caspase-3, cells
Had been obtained from five untreated patients For detection of activated caspase-3, cells with AML (1 M2, two M3, 1 M4 and 1 M5, the had been treated with different…
E costly and none of them can measure drug susceptibility quickly
E high priced and none of them can measure drug susceptibility swiftly inside a point of care setting. The lack of fantastic fast diagnostic tests results in asymptomatic therapy and…
In a mouse model with minimal cytotoxicity (Perwitasari et al., 2014).Screening
In a mouse model with minimal cytotoxicity (Perwitasari et al., 2014).Screening for InhibitorsThe most important challenge in searching for inhibitors that target ubiquitous systems such as nucleocytoplasmic transport for therapeutic…
Nsive to systemic therapy: a case series. Eye (Lond), 2014; 28: 8881 11. Maudgil A
Nsive to systemic therapy: a case series. Eye (Lond), 2014; 28: 8881 11. Maudgil A, Sears KS, Rundle DA et al: Failure of intravitreal bevacizumab within the treatment of choroidal…
Nducted a phase II trial in 27 patients. Eighteen of 27 sufferers had
Nducted a phase II trial in 27 patients. Eighteen of 27 patients had an sophisticated and RAI-refractory DTC and were administered with gefitinib (250 mg/day orally). The extra reported AEs…
Period (Figure one). They were provided a 10-minute mental arithmetic check to
Period (Figure one). They had been offered a 10-minute mental arithmetic test to induce psychological strain just before a 1-hour session of TTM or rest. Instantly soon after mental arithmetic…
Ag Env Gag Gag Env Gag Env D17 89 9 407 435 eight 6 7 2 2 157 D20 105 three 7 11 six 1 1 1 4 14 D22 54 0 0 0 0 44 56 0 0 0 RPKM
Ag Env Gag Gag Env Gag Env D17 89 9 407 435 eight 6 7 2 2 157 D20 105 three 7 11 6 1 1 1 4 14 D22…
Mg/day six weeksCPZ equivalents 600 mgNo side effect43 -Biomolecules 2022, 12,27 ofTable 3. Cont.Agent
Mg/day six weeksCPZ equivalents 600 mgNo side effect43 -Biomolecules 2022, 12,27 ofTable three. Cont.Agent Added Groups of Remedy BI425809 BI425809 RCT BI425809 BI425809 Placebo D-cycloserine Cain et al., 2014 RCT…
Eatment choice for our sufferers will turn out to be increasingly difficult,” he concluded.
Eatment choice for our sufferers will grow to be increasingly challenging," he concluded. lDisclosureDr. Hanna reported economic relationships with AbbVie, Amgen, Astellas Pharma, Inc., Bristol Myers Squibb, and Seattle Genetics.…
Ism that support fast cell proliferation. The aim of the present
Ism that assistance speedy cell proliferation. The aim of your present study was to investigate whether targeting ATP citrate lyase (ACLY), a downstream target of AKT, may well combine with…
, 4) G@T-R+Laser, five) IT-R+Laser, and six) G@IT-R+Laser. Laser irradiation
, four) G@T-R+Laser, five) IT-R+Laser, and six) G@IT-R+Laser. Laser irradiation (1.0 W cm-2 , ten min) was carried out at 12 h postinjection. The tumor volume of orthotopicAdv. Sci. 2023,…
T discover variations in lymphocyte count, D-dimer and procalcitonin levels amongst
T discover differences in lymphocyte count, D-dimer and procalcitonin levels between groups. In summary, the isolated increase in C-reactive protein, without the need of being accompanied by a rise in…
AP increases in SHRs and protected against autonomic dysfunction, suggesting that
AP increases in SHRs and protected against autonomic dysfunction, suggesting that TLR4 is actually a viable option target in the treatment of hypertension. Lately, the notion of an association among…
Local maximum synchrosqueezes type scaling-basis chirplet transformFig 7. Plots with the Renyi
Neighborhood maximum synchrosqueezes form scaling-basis chirplet transformFig 7. Plots from the Renyi entropy vs SNR for various TFA procedures. doi.org/10.1371/journal.pone.0278223.gFig eight. TFA benefits obtained through(a) GLCT,(b) STFT,(c) SET,(d) SST,(e) VSLCT,…
Erol had decreased the drug loading efficiency dramatically from 99.3 to 6.2 [32]. On the other hand
Erol had decreased the drug loading efficiency dramatically from 99.three to six.2 . However, in some situations escalating volume of cholesterol have showed increased drug encapsulation efficiency, as an example…
At probes cg18192808 (DNAJC16) and cg14055589 (TTC17). Variables including the
At probes cg18192808 (DNAJC16) and cg14055589 (TTC17). Elements for instance the retrospective and self-reported measures of coffee and tea intake might explain the discrepancy in findings. A meta-analysis of 15…
Ny locations identified with four flavonoids [78]. five. Conclusions The outcomes in the
Ny areas identified with 4 flavonoids . 5. Conclusions The outcomes with the present study demonstrate the radical scavenging capabilities, anti-inflammatory abilities in each laboratory trials and murine models, and…
Gh efficiency. S. constellatus was observed resistant to erythromycin (57 ), tetracycline (50 ) and
Gh efficiency. S. constellatus was observed resistant to erythromycin (57 ), tetracycline (50 ) and clindamycin (62.five ).Image FeaturesAs shown in Table 3 (Table three), all patients had unilateral empyema,…
Ons would then be a useful tool for improving antimicrobial stewardship
Ons would then be a valuable tool for enhancing antimicrobial stewardship in the neighborhood. It will be also exciting to compare the prescribing habits in multiple European nations; any neighborhood…
L, J Z and JY Z took charge of experiment style
L, J Z and JY Z took charge of experiment style and efficiency. T H, GQ S, HS C, DW R, XY K, ZH Z and QH J carried out…
Inary proof for SOT activity against BA.3 [5] and partial or limited
Inary proof for SOT activity against BA.three and partial or restricted CIL activity against BA.four and BA.five . In accordance with the newest COVID-19 treatment guidelines (files.covid19treatmentguidelines.nih. gov/guidelines/covid19treatmentguidelines.pdf; updated 17…
Cluding compression by muscle fibers, has also been postulated inside the
Cluding compression by muscle fibers, has also been postulated within the pathophysiology such as compression by muscle fibers, has also been postulated within the pathophysiology of NP . The sensory…
Tor of AMPK, metformin, has been linked using a decrease risk
Tor of AMPK, metformin, has been related using a reduce danger for fracture and larger bone density in diabetics working with this drug, as opposed to not applying it .…
Ppropriate TCRs. As a result, this melanoma model recapitulated the variable response to
Ppropriate TCRs. Hence, this melanoma model recapitulated the variable response to ICB observed in sufferers and exhibited biomarkers that differentiate between early response and resistance to remedy, providing a useful…
Om the index patient’ transplanted heart. These biopsies had been kindly provided
Om the index patient' transplanted heart. These biopsies have been kindly supplied by Niguarda Pathological Anatomy Center, Milano, Italy, where the index patient underwent heart transplantation. Twenty -thick paraffine-embedded sections…
Rescribe and monitor physical exercise using the perception of effort for the duration of two
Rescribe and monitor physical exercise with the perception of work through two upperlimb motor tasks: the box and block test and also a pointing job. Our benefits suggest that functionality…
His study, antimicrobial resistance of P. aeruginosa was predicted utilizing a
His study, antimicrobial resistance of P. aeruginosa was predicted employing a data mining assessment framework by machine learning algorithms, as shown in Figure 1. ere were a total of six…
Was transferred to a brand new 96-well plate containing 90 L of a
Was transferred to a brand new 96-well plate containing 90 L of a fresh BM2 with increasing dosages of antimicrobial peptides. Only populations using the highest concentration had been chosen…
VI denote the sum of all total rates out of the
VI denote the sum of all total prices out of your compartment I , i.e., vE = + E + (21)vY1 = 1 + Y1 + (22)vY2 = 2 +…
Indicated on top rated of groups, P-values from Dunn’s a number of comparison
Indicated on top rated of groups, P-values from Dunn's many comparison post-test on leading of pairs: P 0.05; P 0.01; P 0.001; P 0.0001.Anti-CD47 mAb CC2C6 induced a speedy improve…
L genes containing CNVs inside the original P0 tumor and corresponding
L genes containing CNVs within the original P0 tumor and corresponding PDX passages. Heatmap shows PPCC scores for CNVs in P0 tumors and serial passages of (A) OS PDXs HT72,…
Es against TNF- and caspase-3 have been bought from Thermo Fisher Scientific
Es against TNF- and caspase-3 were bought from Thermo Fisher Scientific (Rockford, IL, USA). 2.2. Animal Protocol and Experimental Design and style Male Wistar rats weighing 200 20 g have…
Y obtainable antibodies. Spatial heterogeneities in calcium release in the SR
Y obtainable antibodies. Spatial heterogeneities in calcium release from the SR have also been attributed to heterogeneities in axial and t-tubular structures in atrial myocytes. 20 Even so, preceding research…
— CSM43-Ch– — — 30 — CSM43-T– — — —
-- CSM43-Ch-- -- -- 30 -- CSM43-T-- -- -- -- 30 CSM43-CB-- -- -- -- -- CSM43 20 9 ofFigure different kinds Figure 3. Scanning electron microscope (SEM) pictures with…
75 Antioxidants 2022, 11,12 of 23 12 ofFigure 5. Effects of PL on wrinkles formation-related parameters in
75 Antioxidants 2022, 11,12 of 23 12 ofFigure five. Effects of PL on wrinkles formation-related parameters in NHDF cells: (A) Type I collagen Figure 5. Effects of PL on wrinkles…
Dynamic modifications in EGFR Corresponding author. Corresponding author. E-mail addresses: cailinbo
Dynamic changes in EGFR Corresponding author. Corresponding author. E-mail addresses: cailinbo999@163 (L. Cai), dr_caicunzhou@126 (C. Zhou). 1 Contributed equally to this article. doi.org/10.1016/j.heliyon.2022.e12374 Received 11 March 2022; Received in revised…
T is antibiotic-induced intrinsic DILI, which can be characterized by a closed
T is antibiotic-induced intrinsic DILI, which can be characterized by a closed dose-dependent pathway and predictability. As an example, rifampicin can cause intrinsic DILI, at the same time as idiosyncratic…
R = 20 ). Manage is definitely the handle group, Model is definitely the model group
R = 20 ). Control will be the manage group, Model will be the model group, Higher is definitely the high three.five. The Impact of QLJP on Pulmonary Arteriole Remodeling…
F a diet plan wealthy in fruit and vegetables is also associated
F a diet rich in fruit and vegetables can also be connected with another group of antioxidant elements, i.e., carotenoids. three. Properties of Carotenoids Among the list of groups of…
Ac inflammation in mice right after sympathetic activation in a current study
Ac inflammation in mice immediately after sympathetic activation in a recent study (Nie et al., 2020), suggesting its protective effects on the heart below SNS overactivation. Acute sympathetic strain has…
Under no circumstances smoker status and sophisticated disease5,34,35. A novel observation within the
By no means smoker status and advanced disease5,34,35. A novel observation in the RET fusion-positive NSCLC sufferers was an enrichment of Central and South American, East Asian, and South Asian…
NA, microRNA; FDR, false discovery rate; EGFR, epidermal growth issue receptor
NA, microRNA; FDR, false discovery rate; EGFR, epidermal growth factor receptor; CRC, colorectal cancer.A1.0 0.eight Percent survival 0.six 0.four 0.2 0.0 0CDKN1ALow Group High Group Logrank P=0.043 HR (higher)=0.64 P…
Da (MD): National Library of Medicine (US)) by looking at the
Da (MD): National Library of Medicine (US)) by taking a look at the whole-genome sequence summary (e.g. ncbi.nlm.nih.gov/nuccore/ 223987233). Sequencing information have been converted to relative abundances and multiplied by…
Ls forces, mauve alkyl hydrophobic interactions; (c) the distances ( on the
Ls forces, mauve alkyl hydrophobic interactions; (c) the distances ( with the 1ORE - ionized amantadine interactions.The molecular docking of amantadine with 4X44 results in similar interactions with 1ORE. You…
Ts higher worth. its high worth.Figure 4. Fats most generally discovered
Ts high worth. its higher worth.Figure four. Fats most commonly found in cocoafound in cocoa bean shell: (A) Capric, (B) Palmitic, (C) Stearic and (D) Figure 4. Fats most usually…
Rization of the remaining epoxy groups was characterized by peaks at
Rization with the remaining epoxy groups was characterized by peaks at 312 and 310 C, respectively. Increasing the thermal polymerization temperature to 240 and 270 C, even so, triggered the…
The health authorities suggest a “watchful waiting” or “monitoring” of clinical
The overall health authorities recommend a "watchful waiting" or "monitoring" of clinical evolution as well as the use of symptomatic drugs, for example paracetamol or non-steroidal anti-inflammatory agents (NSAIDs), unless…
CD4 CRTAM KLRD1 CD244 IL18 IL6 CD28 CX3CL1 NCR1 TNFRSF
CD4 CRTAM KLRD1 CD244 IL18 IL6 CD28 CX3CL1 NCR1 TNFRSF4 CD8A ILPromote TI score Vasculature score 2 1 0 -eSuppress Tumor ImmunityIL4 IL5 MCP4 CCL17 CXCL1 CXCL5 CXCL11 PDL2 IL6…
Uently. Final results shown to get a frequency of at the least 12 months.F.
Uently. Outcomes shown for a frequency of at the least 12 months.F. Malik et al.Journal of Virus Eradication 8 (2022)Fig. two. Map displaying regions that responded towards the paediatric HCV…
Tive azoospermia (NOA) (1, 2). NOA, one of the most severe type of impaired male
Tive azoospermia (NOA) (1, two). NOA, by far the most extreme form of impaired male fertility, is definitely the absence of spermatozoa inside the ejaculate brought on by decreased or…
Aflatoxin exposure have sharply decreased the incidence of HCC in current
Aflatoxin exposure have sharply decreased the incidence of HCC in recent decades . HCC screening and early diagnosis, also as advances in surgery and molecular targeted medicine, have considerably reduced…
As quite a few will improve without the need of intervention, routine chest CT-scan will improve
As numerous will improve without intervention, routine chest CT-scan will boost charges and there is certainly no scientific proof that growing corticosteroid dose may have a optimistic effect for these…
, it was shown that the gyrA mutation, conferring resistance against (fluoro-
, it was shown that the gyrA mutation, conferring resistance against (fluoro-)quinolones, may also contribute to a fitness raise in C. jejuni in poultry depending on the strain background .…
Nd LVDD), evaluated by echocardiography. We also located reduction in plasma
Nd LVDD), evaluated by echocardiography. We also identified reduction in plasma levels of cardiac stress markers and lowered heart fibrosis in mdx/CD38mice. Additionally, hearts from mdx/CD38mice have been clearly resistant…
Clemembrane proteins like GPCRs simply because they generate weak points within the
Clemembrane proteins like GPCRs simply because they make weak points within the helix to facilitate movements that happen to be e.g. related with receptor activation (Reiersen and Rees, 2001; Yohannan…
Ypertension. The data in this function revealed that L- or D-cysteine
Ypertension. The information within this function revealed that L- or D-cysteine supplementation enhanced the abundance of several effective bacteria like Butyricicoccus, Bacteroides, and Odoribacter spp. . This outcome was unsurprising…
001 0.001 0.001 0.001 0.630 0.067 0.699 0.602 0.328 0.807 0.002 0.050 0.006 0.013 0.Imply arterial pressure: diastolic arterial pressure + 1/3 pulse stress; Nephrotic syndrome: proteinuria
001 0.001 0.001 0.001 0.630 0.067 0.699 0.602 0.328 0.807 0.002 0.050 0.006 0.013 0.Imply arterial pressure: diastolic arterial pressure + 1/3 pulse pressure; Nephrotic syndrome: proteinuria 3.5g/day and albumin…
Aine; RD, ropivacaine plus dexmedetomidine.the RD group than inside the
Aine; RD, ropivacaine plus dexmedetomidine.the RD group than inside the R group (190 mg vs. 235 mg, P worth = 0.0003). The time for you to injection of rescue analgesics…
S54KO/KO P = 0.0425. Vps54KO/KO vs. Vps54KO/KO
S54KO/KO P = 0.0425. Vps54KO/KO vs. Vps54KO/KO; ppk Vps54 P = 0.0173. All other comparisons n.s. P 0.12. For further organelle parameters, see Fig. S3.involving Vps54 and several sterol and…
For the anatomical location of restricted diffusionClassification Numbers ( ) Location of restricted
To the anatomical location of restricted diffusionClassification Numbers ( ) Place of restricted diffusion Frontal lobe Temporal lobe Parietal lobe Occipital lobe Deep grey matter 0 16 4 18Regional involvement…
Gs. In our multivariate logistic regression analyses with adjusting for confounders
Gs. In our multivariate logistic regression analyses with adjusting for confounders, BA was shown to be related with higher plasma levels of 17 out of 27 cytokines such as inflammatory…
Were intratendineously injected with collagenase [42]. The low solubility of piperine restricted
Have been intratendineously injected with collagenase . The low solubility of piperine restricted the calculation on the IC50 worth. The usage of a self-emulsifying drug-delivery technique proved to enhance the…
Its branches one week after the second dose from the Pfizer
Its branches 1 week after the second dose in the Pfizer BioNTech COVID-19 vaccine. To the very best of our information, that is the first case report of post-COVID-19 vaccine…
Factor receptor 2 (HER2), overexpressed in around 15 -20 of breast carcinomas, conferred
Factor receptor 2 (HER2), overexpressed in roughly 15 -20 of breast carcinomas, conferred a a lot more aggressive phenotype and poorer patient outcomes. 1,2 Having said that, the HER2-targeted therapies…
two.5 two.0 P62 1.five 1.0 0.5 0.0 0 1 TLR(e)Figure five: (a) Correlation evaluation of TLR4 and NF-B.
2.5 two.0 P62 1.five 1.0 0.five 0.0 0 1 TLR(e)Figure 5: (a) Correlation evaluation of TLR4 and NF-B. (b) Correlation analysis of NF-B and Beclin-1. (c) Correlation analysis of NF-B…
Tion offered by the user. The pack-years variable is widely made use of
Tion provided by the user. The pack-years variable is broadly utilised to estimate tobacco consumption through the smoker's life, however the degree of dependence on cigarettes which can estimate the…
E p47phox promoter. ChIP-qPCR showed that LPS stimulation elevated the
E p47phox promoter. ChIP-qPCR showed that LPS stimulation increased the interaction of HIF-1 with all the Ncf1 promoter at site 1 and website two and therefore promoted p47phox expression, which…
D using the relevant native sample (Student’s t-test, Po0.05). (c
D with all the relevant native sample (Student's t-test, Po0.05). (c) Representative GUS staining of mock (upper panel) and PAC treated (decrease panel) seeds harbouring ABI5:GUS or its mutated version…
Ells were lysed and complete cell extracts were immunblotted for HA-DCAF
Ells have been lysed and whole cell extracts had been immunblotted for HA-DCAF11, SLBP and Skp1 (as a loading manage). SLBP levels were quantified and also the level within the…
Species of aflatoxin B1 (1), ionic activated state 1 in path A (TSi
Species of aflatoxin B1 (1), ionic activated state 1 in path A (TSi1), molecular activated state 1 in path B (TSm1), reactive intermediate (1a), activated state 2 path A (TSi1),…
KI) therapy has established value in sufferers with advanced non-small cell
KI) therapy has proven worth in patients with advanced non-small cell lung cancer. Outcomes of the JBR.21 study demonstrated a survival advantage for erlotinib versus best supportive care within the…
Rch Council, revised 2011). Experiments happen to be reported in compliance with all the
Rch Council, revised 2011). Experiments have already been reported in compliance together with the ARRIVE suggestions. All efforts were made to decrease animal suffering and decrease the total number of…
Ients participating in the phase 3 trial, and exposure-MET-survival analyses have already been
Ients participating within the phase three trial, and exposure-MET-survival analyses have already been planned. No dose-dependent urvival partnership was observed within the phase two rilotumumab gastric cancer trial (Iveson et…
(dioctylamino)2-naphthalenyl) ethenyl]-1-(3-sulfopropyl)-, inner salt (di-8-ANEPPS
(dioctylamino)2-naphthalenyl) ethenyl]-1-(3-sulfopropyl)-, inner salt (di-8-ANEPPS; Life Technologies, Carlsbad, CA, Cat. No. D3167). Myofibers have been incubated with di-8-ANEPPS (two.5 lmol/L per L in DMEM media) for three h at 37…
E3 ligase activity (autoubiquitination) of wild-type UHRF1 but not within the
E3 ligase activity (autoubiquitination) of wild-type UHRF1 but not in the UHRF1 K659E mutant, disturbing the UHRF1 domain involved in its interaction with HAUSP . Interestingly, HAUSP interaction with UHRF1…
Per thigh. The tourniquet was composed of 2-0 silk, three.0 metric suture
Per thigh. The tourniquet was composed of 2-0 silk, three.0 metric suture (Ethicon, LLC); suture tension was controlled by a calibrated spring (400 g). Following 45 minutes of ischemia, the…
Effect even within the absence of adaptive immunity suppression. Infiltrating immune
Effect even within the absence of adaptive immunity suppression. Infiltrating immune cells produce active neutrophil elastase in the tumor microenvironment Given that granulocytic MDSCs and neutrophils generate copious amounts of…
Birds, but changed dynamically in CORTand CORT�� birds (figure 2; electronic supplementary
Birds, but changed dynamically in CORTand CORT�� birds (figure 2; electronic supplementary material, table S1). Notably, only birds in the CORTand CORT�� therapies have been observed with viral burdens above…
Amined by QPCR. As shown in Fig. 6C, knocking down of
Amined by QPCR. As shown in Fig. 6C, knocking down of either MCPIP1 or MCPIP4 alone improved the amount of IL-6 mRNA, whereas knocking down each MCPIP1 and MCPIP4 showed…
Rotein FAM65B ADP-ribosylhydrolase-like 1 Ig gamma-2A chain C region Ig
Rotein FAM65B ADP-ribosylhydrolase-like 1 Ig gamma-2A chain C area Ig kappa chain C region, B allele Galectin-1 Dynamin-1-like protein P38 MAPK Phosphate carrier protein, mitochondrial Pyruvate dehydrogenase kinase Pyruvate carboxylase…
And increased CCAAT/enhancer-binding protein alpha (C/EBP) and peroxisome proliferatoractivated
And improved CCAAT/enhancer-binding protein alpha (C/EBP) and peroxisome proliferatoractivated receptor gamma (PPAR) expression . miR-miR-27 is actually a negative regulator of adipocyte differentiation by way of suppressing PPAR and cAMP…
Of chemotherapeutic drugs.two-dimensional rounded colonies less than 1 mm in diameter
Of chemotherapeutic drugs.two-dimensional rounded colonies much less than 1 mm in diameter following exposure to distinctive drug administration situations, namely DTCs (Fig. 2a). To quantitatively measure protein expression of individual…
D cerebellar ataxia, and had been unable to stand by the age
D cerebellar ataxia, and have been unable to stand by the age of 30 . No phenotype was noticed outside of your nervous technique. The Glu7 residue in UCH-L1 is…
Instances at 2-wk intervals, unless otherwise stated. For adoptive transfer experiments
Instances at 2-wk intervals, unless otherwise stated. For adoptive transfer experiments, we utilized wild-type (WT) BALB/c or RT1 TCR-transgenic (Tg) mice (20), in which CD8 T cells recognize the H2-Ddrestricted…
O impaired cardiac mechanics and their relationship to obesity sequelae.LimitationsInter-test
O impaired cardiac mechanics and their partnership to obesity sequelae.LimitationsInter-test and inter-observer reproducibilityThe inter-test and inter-observer variability characteristics for DENSE-derived measures of strain, torsion, and synchrony in mice happen to…
Ated into each national language. The outcomes from our study confirm
Ated into each national language. The outcomes from our study confirm that persons with greater intakes of fruit or vegetables have larger levels of plasma -cryptoxanthin and -carotene. Regardless of…
G the p38 MAPK and MAPK/ERK signaling pathways. Furthermore, prolonged
G the p38 MAPK and MAPK/ERK signaling pathways. Additionally, prolonged p38 MAPK activation was expected for activin A synthesis. These data offer the initial evidence for post-transcriptional handle of INHBA…
L Wellness, Novartis, PsychoGenics, Investigation Foundation for Mental Hygiene, plus the
L Health, Novartis, PsychoGenics, Investigation Foundation for Mental Hygiene, as well as the Singapore National Healthcare Investigation Council. He has presently or within the past 3 years received honoraria from…
Lso a risk aspect.1 Sufferers with renal failure are at risk
Lso a risk element.1 Sufferers with renal failure are at risk on account of platelet/coagulation abnormalities.two RSH has been reported following insertion of peritoneal dialysis catheters and as the very…
Wth issue receptor cross-talk in unanchored tumor cells (26). So far, all
Wth factor receptor cross-talk in unanchored tumor cells (26). So far, all studies on CD318 have already been limited to its direct signaling impact in tumor cells, and its achievable…
E Technique, Toll Like Receptor 4 (TLR4) cascade and MAP kinase activation
E Technique, Toll Like Receptor four (TLR4) cascade and MAP kinase activation in TLR cascade (FDR 1 ). UTL-5g pretreatment did not cause a important transform in phosphorylation of peptides…
Fects of YAP knockdown at substantial cell densities. It has been
Fects of YAP knockdown at substantial cell densities. It's been established that cell density affects growth and neural differentiation in stem cells however the mechanism stays poorly understood. Tropepe et…
Ro and in vivo (Luo et al., 2007; Tanuja Rohatgi et al.
Ro and in vivo (Luo et al., 2007; Tanuja Rohatgi et al., 2004). Thinking about that up-regulation of these pathways occurs inside the brains of individuals with intractable epilepsy (Yuan…
Atment particulars are summarized in Table 3. Seven sufferers (25 ) created a grade
Atment details are summarized in Table three. Seven sufferers (25 ) created a grade two GRP reaction, when 18 individuals (4 ) had a grade three reaction. 3 patients (11…
Eyecups have been incubated with antiintercellular adhesion molecule (ICAM)-2 (1:500 in blocking
Eyecups had been incubated with antiintercellular adhesion molecule (ICAM)-2 (1:500 in blocking buffer, catalog No. 553326; BD Biosciences, San Jose, CA, USA) overnight at 48C. The samples have been then…
Reatment in individuals with renal failure. Actually, this so-called fragile
Reatment in patients with renal failure. Actually, this so-called fragile population (those who are elderly and/or have renal failure and/or are at intense levels of body weight) would be the…
Efects could be highly synergistic with V600EBRAF inhibitors. Offered that
Efects would be very synergistic with V600EBRAF inhibitors. Offered that the aberrations in the apoptotic signaling cascades in melanoma cells are upstream of your activation of procaspase-3, drugs that straight…
T insulin resistance, but T2DM only occurred after the low-dose
T insulin resistance, but T2DM only occurred soon after the low-dose STZ injection. Within this model, we observed that HCHF diet regime seemed to elevate the plasma insulin level just…
And protein synthesis, the quantitative extent of these changes was limited
And protein synthesis, the quantitative extent of those modifications was restricted to 22.three 2.9 improve of protein levels (Fig. 6A6C, supplemental Information S3), indicating an extensive enhancement of protein anabolism,…
S compound parameter settings for declustering potential, entrance prospective and collision
S compound parameter settings for declustering possible, entrance potential and collision cell exit possible had been 80, ten and 10 V respectively. The standards have been characterized working with the…
E Supporting Data of ref 46). This indicates that the electric field
E Supporting Data of ref 46). This signifies that the electric field acting around the transferred electrons, inside the chiral molecule, switches sign upon illumination. The switch within the spin…
That Noni at 500mg.kg-1 could considerably cut down lesion growth from
That Noni at 500mg.kg-1 could considerably cut down lesion growth in the fourth week of therapy. Consequently, the dosage of 500mg.kg-1 was chosen for subsequent protocols. Within this protocol, the…
Ort Worth, University of Chicago, Loyola University Healthcare Center, Summa Akron
Ort Worth, University of Chicago, Loyola University Medical Center, Summa Akron City Hospital/Cooper Cancer Center, Yale University, John Muir Medical Center-Concord Campus, Northside Hospital, UCSF-Mount Zion, Mercy Hospital - Coon…
In the fresh and applied oils was determined applying the Chroma
From the fresh and made use of oils was determined utilizing the Chroma Meter CR-400 technique (Konica Minolta, Japan). The differences in the color in the samples were determined on…
A summary of our phenotypic evaluation is presented in Table 2. Plants
A summary of our phenotypic evaluation is presented in Table 2. Plants with abnormal visual phenotypes account for about 38.6 on the M2 population. Progeny testing in the summers of…
(blue). ELISA quantification of (c) HEL-specific and (d) total IgM in
(blue). ELISA quantification of (c) HEL-specific and (d) total IgM in MD4 plasma treated with either unconjugated or BSA- or HEL-conjugated microspheres. (e) Representative flow cytometry plots and bar graphs…
Regates was counted from a population of a minimum of 300 cells from
Regates was counted from a population of at least 300 cells from three independent transformants. Common deviation is shown. Statistically considerable variations from wildtype or vps5 strains were determined by…
D206 (C068C2; Biolegend) and sacrificed 10sirtuininhibitor0 and 3 min later, respectively.
D206 (C068C2; Biolegend) and sacrificed 10sirtuininhibitor0 and three min later, respectively. For measuring apoptotic cell uptake, 106 thymocytes had been treated for 6 h with 1 dexamethasone (Sigma-Aldrich) and were…
Glycoforms and occupancy of glycosylated web-sites. In addition, the hydrophilic nature of
Glycoforms and occupancy of glycosylated websites. Additionally, the hydrophilic nature of glycans and frequent a number of adduct formation has normally brought on poor retention by reverse phase (RP)-chromatography, decreased…
Hormone therapy 65.six Pain medicationeP values have been calculated for denosumab versus pooled
Hormone therapy 65.six Pain medicationeP values had been calculated for denosumab versus pooled i.v. bisphosphonate information ATC Anatomical Therapeutic Chemical, i.v. intravenousa b c d eATC class: M05B3 ATC class:…
Have been made in GMH clinical management post-ictus (Roberts and Dalziel
Have been produced in GMH clinical management post-ictus (Roberts and Dalziel, 2006; Shankaran et al., 1995). Hemodynamic and respiratory instability in preterm infants leads to fluctuations of cerebral blood flow…
Re. Data have been acquired on a BD FACSCanto II flow cytometer
Re. Data have been acquired on a BD FACSCanto II flow cytometer (Becton, Dickinson and Corporation, Franklin Lakes, NJ, USA) and analyzed with FlowJo (Version 9.six.2, FlowJo, LLC, Ashland, OR,…
20 randomly selected areas is shown ( sirtuininhibitor p sirtuininhibitor 0.001). Scale bar: 500 nm.
20 randomly chosen places is shown ( sirtuininhibitor p sirtuininhibitor 0.001). Scale bar: 500 nm. (F) Panc-1 and MIAPaCa-2 cells were either untreated or treated with WA (1sirtuininhibitor.5 mM) for…
Ate for any five false-positive price by 15 [21]. An additional proposal should be to use
Ate for any five false-positive price by 15 . One more proposal would be to use quantitative "facial profile" markers determined within the exact same plane as NF, pre-nasal thickness…
E solution on the real-time PCR with the exception of Babesia
E item with the real-time PCR using the exception of Babesia spp., which was directly sequenced when probable (i.e., adequate parasitemia present). Sequences had been performed together with the BigDye…
Or infrared absorption bands in the fingerprint area differ by only
Or infrared absorption bands inside the fingerprint area differ by only 1 cm-1, a difference of 12 cm-1 was observed for the amide C=O stretching vibration. The frequency position of…
Significantly expanded the dataset of recognized MACIT sequences and identified MACITs
Considerably expanded the dataset of recognized MACIT sequences and identified MACITs in several phyla in which MACITs were previously unknown. Accession numbers for MACITs from species representative of all the…
Tors.Towards this objective, H1650 or H1975 cells were transiently transfected
Tors.Towards this goal, H1650 or H1975 cells have been transiently transfected with a non-targeting manage siRNA or maybe a Gli1 siRNA. Cells were subsequently treated with 500 nM erlotinib or…
TMENTExtracranial involvement in GCA, or largevessel GCA (LVGCA), has been described
TMENTExtracranial involvement in GCA, or largevessel GCA (LVGCA), has been described in 30 80 of instances, varying in accordance with the imaging modality performed . On the other hand, most…
Etary threonine deficiency has been shown to bring about poor development and
Etary threonine deficiency has been shown to result in poor growth and feed conversion in juvenile Japanese flounder (Paralichthysolivaceus) , at the same time as low protein deposition in fingerling…
Immunoproteasome program named as i-proteasome [18]. The crystal structure showed that i-proteasomes
Immunoproteasome system named as i-proteasome . The crystal structure showed that i-proteasomes have extra enzyme domains, stronger enzymatic activity, and more efficient capacity to degrade the -synuclein proteins. Especially, i-proteasome…
Nd +20 , and above +20 , respectively. 2.four. Search for Optimal Tumor Shrinkage Receiver operating
Nd +20 , and above +20 , respectively. two.four. Search for Optimal Tumor Shrinkage Receiver operating characteristic (ROC) curve was constructed equivalent to that by Krajewski et al with tumor…
N were analyzed each 24 h for 8 days employing the BD FACSAriaII.
N were analyzed every single 24 h for eight days applying the BD FACSAriaII. Experiments have been performed in triplicate; the typical ten,000 cells per gate had been recorded and…
Y reversed by AZD2281 (Figure 3A and B).Drug Design and style, Improvement
Y reversed by AZD2281 (Figure 3A and B).Drug Design and style, Development and Therapy 2015:submit your manuscript | dovepress.comDovepresssui et alDovepressFigure 1 antitumor effects of erlotinib, aZD2281, and erlotinib +…
TsFemale C57BL/6 mice from Baylor College of Medicine were purchased
TsFemale C57BL/6 mice from Baylor College of Medicine were bought and employed at eight weeks of age. All mice were maintained beneath specific pathogen-free conditions within the animal facilities of…
Our group. CNL is somewhat non-toxic to non-malignant tissues, as shown
Our group. CNL is fairly non-toxic to non-malignant tissues, as shown inside the extensive toxicology and stability testing in animals conducted by the Nanotechnology Characterization Laboratory (National Cancer Institute) (Detailed…
Ir; neuraminidase inhibitor; influenza; prophylaxis; post-exposure.Close get in touch with with an influenza
Ir; neuraminidase inhibitor; influenza; prophylaxis; post-exposure.Close contact with an influenza patient increases the threat of subsequent infection. In such instances, antiviral chemoprophylaxis needs to be thought of for persons at…
Mpared with Chinese, around the adipose tissue compartments (i.e., the
Mpared with Chinese, around the adipose tissue compartments (i.e., the pathway independent on the impact of ethnicity on birth weight). The marginal structural model analyses have been carried out together…
Had catheter ablation within two months prior to the index medication and
Had catheter ablation within 2 months prior to the index medication and people who had cardioversion 1 month just before and 1 month immediately after the index medication. Last, we…
2B): Add B27 and 10 M DAPT to N2 medium. Switch neurons
2B): Add B27 and ten M DAPT to N2 medium. Switch neurons in to the N2/B27/DAPT medium. Prepare and modify medium daily. By day 12, 80 of cells will develop…
Female and male mice, we also recognize an unanticipated function for
Female and male mice, we also recognize an unanticipated function for PR in creating and/or keeping sexual dimorphism in splenic leukocyte abundance in this model.Author Manuscript Author Manuscript Results Author…
Uch as adenoviral-mediated overexpression of TRAIL-R1 or IFNg-induced increases in caspase-
Uch as adenoviral-mediated overexpression of TRAIL-R1 or IFNg-induced increases in caspase-8 levels resulted in very higher cell death rates of 7090 ,50 clearly indicating that each excessive anti-apoptotic factors and…
Nfluence around the Tyr-705 phosphorylation of STAT3 (Fig. 4D). Staining with
Nfluence around the Tyr-705 phosphorylation of STAT3 (Fig. 4D). Staining together with the pCaMKII antibody was constructive below the basal culture situations of HaCaT cells, localizing primarily inside the nucleus…
Lved in conjugated metabolite degradation (e.g., carboxypeptidases, phase IV).The
Lved in conjugated metabolite degradation (e.g., carboxypeptidases, phase IV).The metabolic pathways involved in accelerated herbicide degradation that happen to be induced by safeners in crop plants are strikingly comparable to…
;Ampk beta 1fl/fl;Ampk beta 2fl/fl designated AMPK KO;Ampk beta 1fl/fl;Ampk beta 2fl/fl designated AMPK KO
;Ampk beta 1fl/fl;Ampk beta 2fl/fl designated AMPK KO;Ampk beta 1fl/fl;Ampk beta 2fl/fl designated AMPK KO or Ampk beta 1fl/fl;Ampk beta 2fl/fl designated AMPK WT) had been utilized as experimental mice.…
D treatment with an three.5-fold bigger raise than in vehicle-treated miceD remedy with an three.5-fold
D treatment with an three.5-fold bigger raise than in vehicle-treated miceD remedy with an three.5-fold bigger enhance than in vehicle-treated mice (Fig. S3). This getting supports the idea that IB…
E applied to examine gene IL-1 alpha Protein manufacturer expression inside the instances and controlsE
E applied to examine gene IL-1 alpha Protein manufacturer expression inside the instances and controlsE utilised to evaluate gene expression inside the cases and controls, and 2 T was made…
Me of reagent ought to be utilised when supercharging with these twoMe of reagent need
Me of reagent ought to be utilised when supercharging with these twoMe of reagent need to be employed when supercharging with these two new reagents on instruments with FGF-21 Protein…
. Nevertheless, the limited repertoire of B-1 derived IgM might contain specificities. Nonetheless, the limited
. Nevertheless, the limited repertoire of B-1 derived IgM might contain specificities. Nonetheless, the limited repertoire of B-1 derived IgM may well include specificities which are PD-1 Protein Storage &…
Ospective study, where colonic stents showed [20] longterm efficacy comparable to thatOspective study, where colonic
Ospective study, where colonic stents showed longterm efficacy comparable to thatOspective study, where colonic stents showed longterm efficacy comparable to that of surgery . Published followup information are limited for…
In these fits, all of the equilibrium constants and price constantsIn these fits, all of
In these fits, all of the equilibrium constants and price constantsIn these fits, all of the equilibrium constants and price constants were fixed to the values determined in this study…
Ociety of Trauma (DGU) [32]). Entire blood from trauma sufferers was collectedOciety of Trauma (DGU)
Ociety of Trauma (DGU) ). Entire blood from trauma sufferers was collectedOciety of Trauma (DGU) ). Complete blood from trauma patients was collected inside the first six hours after trauma…
Al fluorescence microscopy. (B) YOD1 and TRAF6 co-localize in cytosolic specklesAl fluorescence microscopy. (B) YOD1
Al fluorescence microscopy. (B) YOD1 and TRAF6 co-localize in cytosolic specklesAl fluorescence microscopy. (B) YOD1 and TRAF6 co-localize in cytosolic PTPRC/CD45RA Protein supplier speckles upon co-expression. The co-localization is independent…
(creativecommons.org/publicdomain/zero/1.0/) applies to the information produced offered in(creativecommons.org/publicdomain/zero/1.0/) applies for the data produced readily available
(creativecommons.org/publicdomain/zero/1.0/) applies to the information produced offered in(creativecommons.org/publicdomain/zero/1.0/) applies for the data produced readily available within this report, BNP Protein Purity & Documentation unless otherwise stated.Peluffo et al. Journal of…
Wn are the median TFV and TFVdp concentrations (horizontal line) andWn are the median TFV
Wn are the median TFV and TFVdp concentrations (horizontal line) andWn are the median TFV and TFVdp concentrations (horizontal line) and interquartile variety (vertical lines). An precise Mann-Whitney test was…
Sed complexity of signal perception. Furthermore, the complexity of central elementsSed complexity of signal perception.
Sed complexity of signal perception. Furthermore, the complexity of central elementsSed complexity of signal perception. In addition, the complexity of central components in jasmonic acid ( JAZ5, JAZ5, and JAZ9;…
Dition on day three (Fig. five). To clarify the function of IL-24 inDition on day
Dition on day three (Fig. five). To clarify the function of IL-24 inDition on day three (Fig. 5). To clarify the role of IL-24 inside the MIG/CXCL9 Protein web calcification…
Ine (80 , 0.569 mmol, 1.1 equiv.) and allowed to stir at area temperature
Ine (80 , 0.569 mmol, 1.1 equiv.) and allowed to stir at area temperature forIne (80 , 0.569 mmol, 1.1 equiv.) and allowed to stir at space temperature for 18…
Al significance was determined by 2-tail Student's t-test. p sirtuininhibitorAl significance was determined by 2-tail
Al significance was determined by 2-tail Student's t-test. p sirtuininhibitorAl significance was determined by 2-tail Student's t-test. p sirtuininhibitor 0.01; p sirtuininhibitor 0.001. C. Icaritin (2sirtuininhibitor2 M) up-regulated the Calmodulin…
Niversity, Gifu 501sirtuininhibitor193, Japan2)Graduate 1)Division(Received 18 December 2014/Accepted 26 March 2015/PublishedNiversity, Gifu 501sirtuininhibitor193, Japan2)Graduate 1)Division(Received
Niversity, Gifu 501sirtuininhibitor193, Japan2)Graduate 1)Division(Received 18 December 2014/Accepted 26 March 2015/PublishedNiversity, Gifu 501sirtuininhibitor193, Japan2)Graduate 1)Division(Received 18 December 2014/Accepted 26 March 2015/Published online in J-STAGE 7 April 2015)ABSTRACT. Orf virus (ORFV),…
Indings that these mutants Nectin-4 Protein MedChemExpress undergo little to no autoproteolysis (Jin etIndings that
Indings that these mutants Nectin-4 Protein MedChemExpress undergo little to no autoproteolysis (Jin etIndings that these mutants undergo small to no autoproteolysis (Jin et al., 2007, Chiang et al., 2011)…
Previously been reported as anti-cancer agents, their effects on tumour-suppressor miRNAPreviously been reported as anti-cancer
Previously been reported as anti-cancer agents, their effects on tumour-suppressor miRNAPreviously been reported as anti-cancer agents, their effects on tumour-suppressor miRNA activation are nevertheless largely unknown. Consequently, the development of…
Anufacturer's instructions. Data have been obtained as relative fluorescence units. PulsatileAnufacturer's instructions. Information had been
Anufacturer's instructions. Data have been obtained as relative fluorescence units. PulsatileAnufacturer's instructions. Information had been obtained as relative fluorescence units. Pulsatile shear stress Glass slides were coated with collagen (Sigma-Aldrich,…
No.neuropathy [16]. A few recent research have also shown that DGNo.neuropathy [16]. A handful of
No.neuropathy . A few recent research have also shown that DGNo.neuropathy . A handful of recent studies have also shown that DG induces cognitive enhancement and outcomes in memory recovery…
Aks was corrected by external calibration: the mixture of 0.five L matrixAks was corrected by
Aks was corrected by external calibration: the mixture of 0.five L matrixAks was corrected by external calibration: the mixture of 0.five L matrix solution and 0.5 L Peptide Calibration Common…
Icance p-values are indicated for every single subset. Plotted information are identicalIcance p-values are indicated
Icance p-values are indicated for every single subset. Plotted information are identicalIcance p-values are indicated for every single subset. Plotted data are identical to those presented in Fig two, but…
Cterization of an in vitro modelPLOS 1 | https://doi.org/10.1371/TFRC, Mouse (HEK293, His) journal.Cterization of an
Cterization of an in vitro modelPLOS 1 | https://doi.org/10.1371/TFRC, Mouse (HEK293, His) journal.Cterization of an in vitro modelPLOS 1 | https://doi.org/10.1371/journal.pone.0184439 September 21,18 /E-cadherin and ovarian cancer aggressiveness and prognosisTable…
Minimum of 3 days prior to upward dose titration to a targetMinimum of 3 days
Minimum of 3 days prior to upward dose titration to a targetMinimum of 3 days prior to upward dose titration to a target daily dose of 80 mg/day. After an…
Aradigm, the remedy target in SLE individuals ought to be remission ofAradigm, the treatment target
Aradigm, the remedy target in SLE individuals ought to be remission ofAradigm, the treatment target in SLE patients should be remission of systemic symptoms and organ manifestations or, if remission…
Irus. To this end, cross-subtype antiviral effects of each agents have beenIrus. To this finish,
Irus. To this end, cross-subtype antiviral effects of each agents have beenIrus. To this finish, cross-subtype antiviral effects of each agents have been tested against infections of H3N2, H5N1, H7N7,…
, Li et al., 2008, Koirala et al., 2009, Bae et al., 2014, Ackerman et,
, Li et al., 2008, Koirala et al., 2009, Bae et al., 2014, Ackerman et, Li et al., 2008, Koirala et al., 2009, Bae et al., 2014, Ackerman et al.,…
Th this significant impact of SP, the results of the presentTh this crucial impact of
Th this significant impact of SP, the results of the presentTh this crucial impact of SP, the results of the present study indicated that SP may raise the expression of…
Ese proteins target RHOT1 for removal from the OMM of brokenEse proteins target RHOT1 for
Ese proteins target RHOT1 for removal from the OMM of brokenEse proteins target RHOT1 for removal from the OMM of broken mitochondria causing mitochondrial arrest. (3) RHOT1 is subsequently degraded…
Mplete medium, siRNA oligonucleotides targeting STAT3 gene (CCGTGGAACCATACACAAA) and damaging handleMplete medium, siRNA oligonucleotides targeting
Mplete medium, siRNA oligonucleotides targeting STAT3 gene (CCGTGGAACCATACACAAA) and damaging handleMplete medium, siRNA oligonucleotides targeting STAT3 gene (CCGTGGAACCATACACAAA) and adverse manage siRNA (Guangzhou Ribobio CO., LTD, China) were transfected at…
Nin assay together with the resialylated cRBCs; untreated cRBCs (upper), VCNAtreated cRBCsNin assay using the
Nin assay together with the resialylated cRBCs; untreated cRBCs (upper), VCNAtreated cRBCsNin assay using the resialylated cRBCs; untreated cRBCs (upper), VCNAtreated cRBCs (middle), or 2,6-resialylated cRBCs (bottom) (c). The pictures…
Ner masked for the treatment groups inspected the eyes in theNer masked towards the therapy
Ner masked for the treatment groups inspected the eyes in theNer masked towards the therapy groups inspected the eyes of the rabbits just about every 3 days. The presence of…
5 (GraphPad Software Inc., La Jolla,Rittirsch et al. Crucial Care (2015) 19:Page5 (GraphPad Software program
5 (GraphPad Software Inc., La Jolla,Rittirsch et al. Crucial Care (2015) 19:Page5 (GraphPad Software program Inc., La Jolla,Rittirsch et al. Essential Care (2015) 19:Page five ofCA, USA). Multivariate analyses, which…
4 ranks (3, 2, 1, and 0) from high to low according to phenotypic modifications
4 ranks (3, 2, 1, and 0) from high to low according to phenotypic modifications accordingfour ranks (3, two, 1, and 0) from higher to low according to phenotypic modifications…
Cells in non-human primates (Extended Information Fig. 5i, j). Consistently, theCells in non-human primates (Extended
Cells in non-human primates (Extended Information Fig. 5i, j). Consistently, theCells in non-human primates (Extended Data Fig. 5i, j). Consistently, the kinetics of infection was various among the two ZIKV…
Ment (ARE) [19]. Below normal physiological circumstances, Nrf2 is bound to Kelch-likeMent (ARE) [19]. Beneath
Ment (ARE) . Below normal physiological circumstances, Nrf2 is bound to Kelch-likeMent (ARE) . Beneath standard physiological circumstances, Nrf2 is bound to Kelch-like ECH-associated protein 1 (Keap1), top Nrf2 to…
Endent response curve as shown in Figure 2C . Second, SEMA3AEndent response curve as shown
Endent response curve as shown in Figure 2C . Second, SEMA3AEndent response curve as shown in Figure 2C . Second, GSTP1, Human SEMA3A does not alter the present density of…
Have been terminated by addition of 10^ loading buffer and analyzed by electrophoresisWere terminated by
Have been terminated by addition of 10^ loading buffer and analyzed by electrophoresisWere terminated by addition of 10^ loading buffer and analyzed by electrophoresis on 1 agarose gels and staining…
E (BM) proteins in good correlation with their ability to bindE (BM) proteins in great
E (BM) proteins in good correlation with their ability to bindE (BM) proteins in great correlation with their capability to bind them and to induce profuse bleeding in vivo. The…
mitochondrial energetic deficiency with aging has been well-documented (McMillin et al.Mitochondrial energetic deficiency with aging
mitochondrial energetic deficiency with aging has been well-documented (McMillin et al.Mitochondrial energetic deficiency with aging has been well-documented (McMillin et al., 1993; Fannin et al., 1999; Phaneuf and CD59 Protein…
Sion of YAP in HuCCT-1 cells treated with car or FGFSion of YAP in HuCCT-1
Sion of YAP in HuCCT-1 cells treated with car or FGFSion of YAP in HuCCT-1 cells treated with vehicle or FGF5 (10 ng/ml) for 24 h. Imply S.E. are depicted…
Greater than 50 of your drugs presently out there are natural substances orGreater than
Greater than 50 of your drugs presently out there are natural substances orGreater than 50 from the drugs at present obtainable are organic substances or associated compounds5. In vitro screening…
E are presented. To compare unadjusted power and nutrient intake estimatedE are presented. To examine
E are presented. To compare unadjusted power and nutrient intake estimatedE are presented. To examine unadjusted energy and nutrient intake BRD4, Human (His-Flag) estimated by the two techniques, the 4-d…
Rsity of Pittsburgh, Pittsburgh, Pennsylvania 15260, Usa CONSPECTUS: Molecular spintronics (spinRsity of Pittsburgh, Pittsburgh, Pennsylvania
Rsity of Pittsburgh, Pittsburgh, Pennsylvania 15260, Usa CONSPECTUS: Molecular spintronics (spinRsity of Pittsburgh, Pittsburgh, Pennsylvania 15260, United states CONSPECTUS: Molecular spintronics (spin + electronics), which aims to exploit both the…
Ividual cells (as suggested by measurements of protein1,53 and transcript levelsIvidual cells (as recommended by
Ividual cells (as suggested by measurements of protein1,53 and transcript levelsIvidual cells (as recommended by measurements of protein1,53 and transcript levels64) and as a result would contribute for the emergent…
) S7 Photoset. Images of Saratin, Ilomastat, and Avastin remedy, Part 2. (ZIP) S7 Photoset.
) S7 Photoset. Images of Saratin, Ilomastat, and Avastin remedy, Part 2. (ZIP) S7 Photoset. Pictures of Saratin, Ilomastat, and Avastin remedy, Aspect 2. (ZIP)AcknowledgmentsThanks to LPath for the contribution…
Uma patients' threat for creating of nosocomial infections at any timeUma patients' risk for building
Uma patients' threat for creating of nosocomial infections at any timeUma patients' risk for building of nosocomial infections at any time point, the hierarchical combination of HP expression (principal level)…
Fluid (gout). Individuals had been classified as getting unclassified arthritis (UA) ifFluid (gout). Patients had
Fluid (gout). Individuals had been classified as getting unclassified arthritis (UA) ifFluid (gout). Patients had been classified as having unclassified arthritis (UA) if they did not meet any classification criteria.…
Irtuininhibitor 0.0001, ns not significantmeasured. Due to the dynamic nature of yourIrtuininhibitor 0.0001, ns not
Irtuininhibitor 0.0001, ns not significantmeasured. Due to the dynamic nature of yourIrtuininhibitor 0.0001, ns not significantmeasured. Because of the dynamic nature with the expression patterns from the organizer genes, care…
Gy utilizing atomic force microscopy (AFM). Visualization of CNP uptake intoGy making use of atomic
Gy utilizing atomic force microscopy (AFM). Visualization of CNP uptake intoGy making use of atomic force microscopy (AFM). Visualization of CNP uptake into cells was studied by fluorescein isothiocyanate (FITC)…
In these fits, all the equilibrium constants and rate constantsIn these fits, all of the
In these fits, all the equilibrium constants and rate constantsIn these fits, all of the equilibrium constants and price constants had been fixed to the values determined in this study…
five (GraphPad Software Inc., La Jolla,Rittirsch et al. Essential Care (2015) 19:Page5 (GraphPad Software Inc.,
five (GraphPad Software Inc., La Jolla,Rittirsch et al. Essential Care (2015) 19:Page5 (GraphPad Software Inc., La Jolla,Rittirsch et al. Vital Care (2015) 19:Page 5 ofCA, USA). Multivariate analyses, such as…
Eated with bendamustine in mixture with either Streptavidin Magnetic Beads Publications 4-OHCY or cytosine arabinoside.
Eated with bendamustine in mixture with either Streptavidin Magnetic Beads Publications 4-OHCY or cytosine arabinoside. Bendamustine alone arrested target cells within the late S phase, whereas cytosine arabinoside brought on…
Lasma membrane integrity will let access of biotin to intracellular proteins. Western blotting for a
Lasma membrane integrity will let access of biotin to intracellular proteins. Western blotting for a protein expressed exclusively in an intracellular compartment for example the endoplasmic reticulum may be utilised…
Ody following resumption of abatacept treatment may reflect the immunomodulatory effectOdy after resumption of abatacept
Ody following resumption of abatacept treatment may reflect the immunomodulatory effectOdy after resumption of abatacept remedy may well reflect the immunomodulatory impact in the drug. The present study has quite…
Nalysis indicated that -SPGG-2 (4c) was composed of hepta- to dodeca-sulfatedNalysis indicated that -SPGG-2 (4c)
Nalysis indicated that -SPGG-2 (4c) was composed of hepta- to dodeca-sulfatedNalysis indicated that -SPGG-2 (4c) was composed of hepta- to dodeca-sulfated species (Figure 1A). A easy analysis suggests that 455-6455…
Ediatric individuals who had been referred to outpatientIran J Pediatr; Vol 24 (No two), Apr
Ediatric individuals who had been referred to outpatientIran J Pediatr; Vol 24 (No two), Apr 2014 Published by: Tehran University of Healthcare Sciences (ijp.tums.ac.ir)Rostami P, et alVisits took place at…
Vels of plasma glucose, glycosylated hemoglobin (HbA1c) and plasma lipids, the homeostasis model assessment-insulin secretion
Vels of plasma glucose, glycosylated hemoglobin (HbA1c) and plasma lipids, the homeostasis model assessment-insulin secretion index (HOMA- ) and HOMA-insulin resistance index (HOMA-IR), as well because the incidence of hypoglycemia,…
CT116 and ccD841 cells have been treated with vehicle or 15 M ITc and entire
CT116 and ccD841 cells have been treated with vehicle or 15 M ITc and entire cell lysates were immunoblotted at 24 h for ph2aX and phosphorylated Rpa32 at s4/s8. Data…
Rejection. Basement membrane in human placenta-derived ECM could execute a functionalRejection. Basement membrane in human
Rejection. Basement membrane in human placenta-derived ECM could execute a functionalRejection. Basement membrane in human placenta-derived ECM could carry out a functional component within the well regeneration of damaged basement…
Supplements are readily available for figure two: Figure IFN-alpha 1/IFNA1 Protein Storage & Stability supplement
Supplements are readily available for figure two: Figure IFN-alpha 1/IFNA1 Protein Storage & Stability supplement 1. Xylosyl-xylitol oligomers generated inSupplements are available for figure 2: Figure supplement 1. Xylosyl-xylitol oligomers…
Ans showing (A) the insertion of cryoprobes into metastatic lesions and (B) the monitoring with
Ans showing (A) the insertion of cryoprobes into metastatic lesions and (B) the monitoring with the region of ablation, and (C) making certain the ablation area entirely covers the lesion.…
Represents the least abundant amino acid within the cell throughout development on malate (Fig. two;
Represents the least abundant amino acid within the cell throughout development on malate (Fig. two; Table S1). Determination of fatty acids revealed the presence of compounds with chain lengths of…
Nt using the observations in Figure two mercury RSPO1/R-spondin-1, Human (CHO, His) exposure of B10.S
Nt using the observations in Figure two mercury RSPO1/R-spondin-1, Human (CHO, His) exposure of B10.S mice resulted in substantial increases in the expression of IFNc, TNF-a, IL-1b, and NRLP3 (P…
Ent internet sites fulfill the necessity of quality normal, and the crudeEnt web pages fulfill
Ent internet sites fulfill the necessity of quality normal, and the crudeEnt web pages fulfill the requirement of high-quality typical, as well as the crude drug from tissue culture RSPO3/R-spondin-3…
Component masses was applied to calculate the typical molecular weights ofComponent masses was used to
Component masses was applied to calculate the typical molecular weights ofComponent masses was used to calculate the average molecular weights from the SPGG IL-7 Protein custom synthesis Variants (see Supporting…
Ite powder (0.040 g, 77 ) followed by reverse phase flash chromatography (NH2 capped SiO2,
Ite powder (0.040 g, 77 ) followed by reverse phase flash chromatography (NH2 capped SiO2, three g, 100 CH2Cl2) for biological evaluation: TLC Rf = 0.1 (five MeOH/ CH2Cl2); mp…
Atology, College of Dentistry, University of S Paulo, S Paulo, SP, Brazila; Department
Atology, College of Dentistry, University of S Paulo, S Paulo, SP, Brazila; Department of Pharmacology, Institute of Biomedical Sciences, University of S Paulo, S Paulo, SP, BrazilbProtease-activated receptor 2 (PAR2)…
Olonized by numerous trillions of microbes, which collectively possess a huge selection of instances as
Olonized by numerous trillions of microbes, which collectively possess a huge selection of instances as a lot of genes as coded for by the human genome. The combined genetic potential…
Ed. Among the general population, the BRS sensitivity was 0.76 and specificityEd. Amongst the overall
Ed. Among the general population, the BRS sensitivity was 0.76 and specificityEd. Amongst the overall population, the BRS sensitivity was 0.76 and Thrombomodulin Protein Formulation Specificity was 0.64. The good…
Supplements are readily available for figure 2: Figure supplement 1. Xylosyl-xylitol oligomers generated inSupplements are
Supplements are readily available for figure 2: Figure supplement 1. Xylosyl-xylitol oligomers generated inSupplements are out there for figure 2: Figure supplement 1. Xylosyl-xylitol oligomers generated in yeast cultures with…
Ne was identified in our STM screen as impacting upon virulence (Figure 3). PduQ is
Ne was identified in our STM screen as impacting upon virulence (Figure 3). PduQ is involved in degradation of 1,2-propanediol (1,2-PD). It is actually a propanol dehydrogenase that converts propionaldehyde…
The possibility that corresponding effects could possibly bePLOS One | plosone.orgobserved with FAE treatment in
The possibility that corresponding effects could possibly bePLOS One | plosone.orgobserved with FAE treatment in humans with metabolic disturbances associated with enhanced levels of CRP.gp140, HIV-1 (627a.a, HEK293, Fc) Materials…
In PMC 2015 April 19.Schwartz et al.Pageconcentrations. Having said that, none with the other tetracycline-derived
In PMC 2015 April 19.Schwartz et al.Pageconcentrations. Having said that, none with the other tetracycline-derived compounds decreased cell killing during chemical hypoxia at any concentration examined (Suppl. Table 1). Minocycline…
Ere cultivated around the airside from the scaffolds with a densityEre cultivated around the airside
Ere cultivated around the airside from the scaffolds with a densityEre cultivated around the airside of the scaffolds having a density of about 105 cells per cm2 in fibroblast medium…
Ll voxels inside the brain (GS) was integrated as a nuisanceLl voxels inside the brain
Ll voxels inside the brain (GS) was integrated as a nuisanceLl voxels inside the brain (GS) was incorporated as a nuisance predictor and regressed out to produce a residual BOLD…
Ery (1)Revision surgery+oral CS (1) Oral CS (1)/revision surgery (1)Oral CS (two) EFRS (13) Surgery
Ery (1)Revision surgery+oral CS (1) Oral CS (1)/revision surgery (1)Oral CS (two) EFRS (13) Surgery (6) Surgery+oral CS (7)Surgery (1) Revision surgery (1)/revision surgery+oral CS (1)/oral CS (1)Revision surgery (2)/revision…
S, the insulinogenicindex tended to boost in parallel with all the statistically significant decrease of
S, the insulinogenicindex tended to boost in parallel with all the statistically significant decrease of insulin sensitivity, enabling to retain the glucose disposition index unchanged and to compensate for the…
E outcomes (Fig. four) showed that the magnitude of antibody response was time dependent with
E outcomes (Fig. four) showed that the magnitude of antibody response was time dependent with the rVCG-Pmp18D vaccine displaying an immunogenic benefit. In general rVCG-Pmp18D-immunized mice developed significantly larger (P…
Hat nonionic forces contribute almost 87 of binding energy suggesting a strongHat nonionic forces
Hat nonionic forces contribute almost 87 of binding energy suggesting a strongHat nonionic forces contribute nearly 87 of binding energy suggesting a strong possibility of particular interaction. All round, the…
Lysis also confirmed that the fetal aIMT observed during pregnancy byultrasoundLysis also confirmed that the
Lysis also confirmed that the fetal aIMT observed during pregnancy byultrasoundLysis also confirmed that the fetal aIMT observed in the course of pregnancy byultrasound corresponded to intima thickening. The CD68,…
The C-terminal region was not totally crucial for viability, but clearly bolstered Slpr function, such
The C-terminal region was not totally crucial for viability, but clearly bolstered Slpr function, such as activation of puc-lacZ within the embryo plus the adult (Figure 4, Figure five, and…
Nesis, can be a major one (6-16). The activation of the AKT pathway promotes the
Nesis, can be a major one (6-16). The activation of the AKT pathway promotes the transition from anaplastic astrocytoma to glioblastoma (17), is correlated to histological IL-27, Human (CHO, His)…
Motility assays were MIP-2/CXCL2 Protein web carried out with 6-day old schistosomulae inside the similar
Motility assays were MIP-2/CXCL2 Protein web carried out with 6-day old schistosomulae inside the similar manner, but without the need of the transfection with siRNA. Baseline measurements of schistosomula motility…
Regional recurrence. SUV max-2weeks in regional handle was 7.7 2.7 and .eight 1.8
Regional recurrence. SUV max-2weeks in regional handle was 7.7 2.7 and .eight 1.8 inRegional recurrence. SUV max-2weeks in regional IL-17A, Mouse (HEK293, His) manage was 7.7 two.7 and .eight 1.eight…
Supplements are out there for figure two: Figure supplement 1. Xylosyl-xylitol oligomers generated inSupplements are
Supplements are out there for figure two: Figure supplement 1. Xylosyl-xylitol oligomers generated inSupplements are readily available for figure two: Figure supplement 1. Xylosyl-xylitol oligomers generated in yeast cultures with…
Licate. (d) Western blot evaluation of POSTN expression in EPC-hTERT- p53R175H-POSTN and EPC-hTERT- p53R175H-neo cell
Licate. (d) Western blot evaluation of POSTN expression in EPC-hTERT- p53R175H-POSTN and EPC-hTERT- p53R175H-neo cell lysates and conditioned media after 24 h treatment with 5-ID (Vehicle, 0.5 mM, 1 mM…
Rding to distinctive authors[18, 21]. There are two isoforms of cyclooxygenases, referred to as COX-1
Rding to distinctive authors. There are two isoforms of cyclooxygenases, referred to as COX-1 and COX-2. COXs take part in numerous physiological functions and pathological disorders related with endothelial dysfunction…
Hite soybean (33.8 protein). Denis et al. (24) reported that the composition of Grateloupia
Hite soybean (33.8 protein). Denis et al. (24) reported that the composition of Grateloupia turuturu, edible red seaweed in France, was 18.5 ash, 22.9 total protein, and 2.six total lipid.…
Ignals that happen to be known to be released in response to aIgnals that are
Ignals that happen to be known to be released in response to aIgnals that are known to become released in response to a wide array of stimuli like infection or…
N UCB (case 114) tissue showed high expression of YAP 1, in whichN UCB (case
N UCB (case 114) tissue showed high expression of YAP 1, in whichN UCB (case 114) tissue showed higher expression of YAP 1, in which extra than 90 of tumor…
Tested the effects of VPA (0.5 mM) and dasatinib (5 mM) on cell cycle progression
Tested the effects of VPA (0.5 mM) and dasatinib (5 mM) on cell cycle progression in these cells. Figure 3 shows that the dasatinib-VPA mixture resulted within a significantly higher…
Uthor Manuscript NIH-PA Author ManuscriptJ Speech Lang Hear Res. Author manuscript; out there in PMC
Uthor Manuscript NIH-PA Author ManuscriptJ Speech Lang Hear Res. Author manuscript; out there in PMC 2015 February 12.Bone et al.PageSimilar towards the child's characteristics, the psychologist's median jitter, rs(26) =…
Was created up to the mark using the mobile phase to obtain a answer containing
Was created up to the mark using the mobile phase to obtain a answer containing 30 /ml of DIC. This solution was utilized for the estimation of DIC. The resolution…
Eventually accumulated in thehuman physique. In specific, lanthanum (La) is 1Sooner or later accumulated in
Eventually accumulated in thehuman physique. In specific, lanthanum (La) is 1Sooner or later accumulated in thehuman physique. In particular, lanthanum (La) is amongst the most significant REE widely researched in…
Sions were terminated when the remaining substrate concentration dropped below 20 mMSions had been terminated
Sions were terminated when the remaining substrate concentration dropped below 20 mMSions had been terminated when the remaining substrate concentration dropped below 20 mM according to GCMS. The solution was…
Eated with bendamustine in combination with either 4-OHCY or cytosine arabinoside. Bendamustine alone arrested target
Eated with bendamustine in combination with either 4-OHCY or cytosine arabinoside. Bendamustine alone arrested target cells inside the late S phase, whereas cytosine arabinoside triggered early S-phase block in HBL-2…
D at distinct gestational ages with or without having labour, induction and intrauterine inflammation. We've
D at distinct gestational ages with or without having labour, induction and intrauterine inflammation. We've described novel protein IFN-beta Protein Source localisation and gene expression patterns that increase our understanding…
Een fluorescent dye, carboxyfluorescein (CFSE), which gave the highest signal-to-background ratio using the Miniature microscope
Een fluorescent dye, carboxyfluorescein (CFSE), which gave the highest signal-to-background ratio using the Miniature microscope when in comparison to stably transfected and transiently transfected 4T1-GL cells (Fig. 2F), enabling to…
Approximately, eight.24 acre). Roots and rhizomes of tissue culture plants and plantsApproximately, eight.24 acre). Roots
Approximately, eight.24 acre). Roots and rhizomes of tissue culture plants and plantsApproximately, eight.24 acre). Roots and rhizomes of tissue culture plants and plants from seed (3-year old) had been harvested…
Isib has demonstrated antiproliferative, pro-apoptotic and antitumor activity in cancer cellIsib has demonstrated antiproliferative, pro-apoptotic
Isib has demonstrated antiproliferative, pro-apoptotic and antitumor activity in cancer cellIsib has demonstrated antiproliferative, pro-apoptotic and antitumor activity in cancer cell lines and tumor xenograft models, as a single agent(6)…
Rated, oral DMT fingolimod are considerably a lot more most likely to be adherent to
Rated, oral DMT fingolimod are considerably a lot more most likely to be adherent to therapy and less likely to discontinue their medication than those treated with injectable DMTs .…
Esults could open avenues to engineering of new compounds that don't act by means of
Esults could open avenues to engineering of new compounds that don't act by means of cellular processes, but specifically target the mineral and collagen interface to enhance hydration and energy…
Relevance for practicing anesthesiologists that need to see an integration of exome information are going
Relevance for practicing anesthesiologists that need to see an integration of exome information are going to be genotype-based perioperative drug therapy. Although clinical integration of exome benefits continues to be…
Basically halted other clinical trials of Coxibs for cancer chemoprevention. NumerousEssentially halted other clinical trials
Basically halted other clinical trials of Coxibs for cancer chemoprevention. NumerousEssentially halted other clinical trials of Coxibs for cancer chemoprevention. Various studies have also reported that NSAIDs cut down the…
Ation efficiency (twice as substantially as the unstimulated handle). We successfullyAtion efficiency (twice as much
Ation efficiency (twice as substantially as the unstimulated handle). We successfullyAtion efficiency (twice as much as the unstimulated control). We effectively yielded hugely pure ErbB4/HER4 supplier CMVpp65-specific T cells from…
Ling evidence of a pharmacodynamic element to MPH-ethanol interactions, outcomes in potentiated stimulant effects and
Ling evidence of a pharmacodynamic element to MPH-ethanol interactions, outcomes in potentiated stimulant effects and heightened abuse liability of MPH.10,11 The present review chronicles the pharmaceutical literature pertaining to EPH:…
E peaches are non-melting (79 , More file 12: Table S8). The prospective for predicting
E peaches are non-melting (79 , More file 12: Table S8). The prospective for predicting fruit form was assessed. The genotypes were divided in accordance with the ideotype with the…
Ffects.26,33 The pmKATP channels is often activated when cytoplasmic ATP is depleted, leading to shortening
Ffects.26,33 The pmKATP channels is often activated when cytoplasmic ATP is depleted, leading to shortening of action prospective and reduced membrane depolarization, consequently reducingCell Death and Diseaseintracellular calcium overload.51 Presently,…
Erent regions of your substrate, such that (i) the group characterizedErent regions from the substrate,
Erent regions of your substrate, such that (i) the group characterizedErent regions from the substrate, such that (i) the group characterized by pKU1, which interacts using the portion released right…
Supplements are Cathepsin L Compound readily available for Figure 2: Figure supplement 1. Xylosyl-xylitol oligomers
Supplements are Cathepsin L Compound readily available for Figure 2: Figure supplement 1. Xylosyl-xylitol oligomers generated inSupplements are out there for figure 2: Figure supplement 1. Xylosyl-xylitol oligomers generated in…
Ant and anti-inflammatory effects of T. scordium extract in the aged rats. Our outcomes indicated
Ant and anti-inflammatory effects of T. scordium extract in the aged rats. Our outcomes indicated that T. scordium decreases inflammatory mediators and increases anti-oxidative power and steroid hormones in aged…
Stern blotting to detect cytoplasmic and nuclear proteins. Transfection and Immunoprecipitation HEK293 T cells plated
Stern blotting to detect cytoplasmic and nuclear proteins. Transfection and Immunoprecipitation HEK293 T cells plated in 10 cm dishes have been transfected with all the indicated PPARα Inhibitor Synonyms plasmids…
Rap+/+ mice. Regional adipose tissue ATRAP may be a modulator of adipokine production and inflammation
Rap+/+ mice. Regional adipose tissue ATRAP may be a modulator of adipokine production and inflammation that exerts valuable regulatory effects around the Dopamine Receptor Agonist review Function of adipocytes and…
Anti-FSHR antibody (150 pgml) (17). Intracellular cAMP levels had been measured with a commerciallyAnti-FSHR antibody
Anti-FSHR antibody (150 pgml) (17). Intracellular cAMP levels had been measured with a commerciallyAnti-FSHR antibody (150 pgml) (17). Intracellular cAMP levels had been measured using a commercially out there kit…
Difications. In brief, 20 g beechwood xylan (Sigma ldrich) was totally suspendedDifications. In short, 20
Difications. In brief, 20 g beechwood xylan (Sigma ldrich) was totally suspendedDifications. In short, 20 g beechwood xylan (Sigma ldrich) was completely suspended in 1000 ml water, to which 13.six…
Oildye suspension as you possibly can with out disturbing the pellet, which was setOildye suspension
Oildye suspension as you possibly can with out disturbing the pellet, which was setOildye suspension as you can with no disturbing the pellet, which was set aside for reuse. We…
F R, Gabone RM, Mugashe C, Obiga D, Ramarokoto CE, Mahlert C, Spannbrucker N, Lang
F R, Gabone RM, Mugashe C, Obiga D, Ramarokoto CE, Mahlert C, Spannbrucker N, Lang A, Gunzler V, Gryseels B, Ehrich JH, Doehring E. Schistosoma mansoni-related morbidity on Ukerewe Island,…
From rats subjected to cIAP-1 Antagonist custom synthesis hypoxia (for ten min or 3 h)
From rats subjected to cIAP-1 Antagonist custom synthesis hypoxia (for ten min or 3 h) or regular controls were randomized into 13 groups (n=8/group): control, control+control siRNA, control+caffeine, 10-min hypoxia,…
C style are all important for FXIa recognition. It is actually much moreC style are
C style are all important for FXIa recognition. It is actually much moreC style are all crucial for FXIa recognition. It's more probably that fewer sulfate groups placed at important…
And E). These data revealed that a bypassing mechanism of PIAnd E). These information revealed
And E). These data revealed that a bypassing mechanism of PIAnd E). These information revealed that a bypassing mechanism of PI3KAkt signalling targets autophagy inhibition dependent on mTOR suppression, which…
Ation with the BCAR4 RNA probe (nt 235-288) and (nt 991-1044) with recombinant SNIP1 and
Ation with the BCAR4 RNA probe (nt 235-288) and (nt 991-1044) with recombinant SNIP1 and PNUTS, respectively, resulted in distinct gel retardation (Figure 2H). Under these circumstances, no shift was…
Ydrate Sodium phosphate dibasic Sodium phosphate monobasic monohydrate Sodium sulfate Formula NH4Cl (NH4)2C6H6O7 NH4(HCO2) NH4(H2PO4)
Ydrate Sodium phosphate dibasic Sodium phosphate monobasic monohydrate Sodium sulfate Formula NH4Cl (NH4)2C6H6O7 NH4(HCO2) NH4(H2PO4) (NH4)2SO4 CaCl2 CaSO4 Li2SO4 2O MgSO4 MgSO4?H2O KCl KH2PO4 KNaC4H4O6 ?H2O Na(CH3CO2) NaCl Na3C6H5O7 ?H2O…
Roofreading Phusion Higher Fidelity Polymerase (New England Biolabs), according to common protocols. PCR primers (Table
Roofreading Phusion Higher Fidelity Polymerase (New England Biolabs), according to common protocols. PCR primers (Table S2) were created using Oligo6.two along with the exclusive Estrogen receptor Agonist medchemexpress fragment sequences…
Rejection. Basement membrane in human placenta-derived ECM could PIM2 manufacturer perform a functionalRejection. Basement membrane
Rejection. Basement membrane in human placenta-derived ECM could PIM2 manufacturer perform a functionalRejection. Basement membrane in human placenta-derived ECM could perform a functional component within the properly regeneration of damaged…
S had been initiated by mixing equal volumes of your cell suspensionS have been initiated
S had been initiated by mixing equal volumes of your cell suspensionS have been initiated by mixing equal volumes in the cell suspension and also the substrate stock. Reactions were…
Lated), hepatic failure (not related), and mAChR4 list asthenia (not related) in 1 patient every.
Lated), hepatic failure (not related), and mAChR4 list asthenia (not related) in 1 patient every. Many of the grade 5 AEs in both treatment arms were reported in individuals whose…
Egas P, L ez C: Bioinformatic identification of cassava miRNAs differentially expressed in response to
Egas P, L ez C: Bioinformatic identification of cassava miRNAs differentially expressed in response to infection by Xanthomonas axonopodis pv. Manihotis. BMC Plant Biol 2012, 12:29. Murashige T, Skoog F:…
Nctions resolve by attenuating the underlying gut inflammation or by ocular administration of anti-inflammatory steroids.
Nctions resolve by attenuating the underlying gut inflammation or by ocular administration of anti-inflammatory steroids. Having said that, IBD has been located to become hard to treat inside a considerable…
Enhanced amounts of BAFF may well favor choice of autoreactive B cellsElevated levels of BAFF
Enhanced amounts of BAFF may well favor choice of autoreactive B cellsElevated levels of BAFF might favor choice of autoreactive B cells,35 TRPA supplier potentially expanding the likelihood of GPA…
Olic fraction (Fig. 6B). On the other hand, whilst we expressedOlic fraction (Fig. 6B). However,
Olic fraction (Fig. 6B). On the other hand, whilst we expressedOlic fraction (Fig. 6B). However, though we expressed DHFR alone having a 3 -HA tag, we discovered that the expressed…
Of Sox9. J Bone Miner Metab. 2011; 29:123?29. [PubMed: 20676705] Liu A, Niswander LA. Bone
Of Sox9. J Bone Miner Metab. 2011; 29:123?29. Liu A, Niswander LA. Bone morphogenetic protein signalling and vertebrate nervous program improvement. Nature critiques. Neuroscience. 2005; six:945?54. Logan M, Martin JF,…
Vol/vol) of DSMO]). Due to its maximal effect, the higher concentration was utilised in subsequent
Vol/vol) of DSMO]). Due to its maximal effect, the higher concentration was utilised in subsequent experiments. The addition of 5 fetal bovine serum did not diminish raloxifene's constructive effect on…
F the extracts of rathippocampus respectively (a, b). The quantitative evaluation of b was performed
F the extracts of rathippocampus respectively (a, b). The quantitative evaluation of b was performed with 1 unit as that obtained inside the handle group (normalized against total tau probed…
C fashion are all important for FXIa recognition. It really is a lot moreC fashion
C fashion are all important for FXIa recognition. It really is a lot moreC fashion are all essential for FXIa recognition. It can be additional likely that fewer sulfate groups…
Component masses was applied to calculate the average molecular weights ofElement masses was used to
Component masses was applied to calculate the average molecular weights ofElement masses was used to calculate the average molecular weights from the SPGG variants (see Supporting Data Table S1 and…
E (2,two,6-Trimethylbicyclo[4.1.0]hept-1-yl)-methanol Allopregnane-7,11-diol-3,20-dione Nerolidol isobutyrate four,8,13-Duvatriene-1,3-diolRIa 1687 1435 1398 1690 1794 2523 1431 2190 1523
E (2,two,6-Trimethylbicyclohept-1-yl)-methanol Allopregnane-7,11-diol-3,20-dione Nerolidol isobutyrate four,8,13-Duvatriene-1,3-diolRIa 1687 1435 1398 1690 1794 2523 1431 2190 1523 2211 1953 1454 1530 1530 1438 1752 1889 2956 1673 1794 1889b 0.24 0.30 five.61…
S three extra amino acid adjustments inside the B sub-unit from that of LT1 (15,
S three extra amino acid adjustments inside the B sub-unit from that of LT1 (15, 25). The LT4 variant is normally located in porcine ETEC strains, and it really is…
Nfarction control (Fig. 2D), aBiomaterials. Author manuscript; offered in PMC 2014 October 01.Hashizume et al.Pagesignificant
Nfarction control (Fig. 2D), aBiomaterials. Author manuscript; offered in PMC 2014 October 01.Hashizume et al.Pagesignificant lower in infarction size ( ventricular circumference) was observed inside the PECUU and PCUU, but…
Behavior described in Figure 4. Additionally, the difference among k2 and kBehavior described in Figure
Behavior described in Figure 4. Additionally, the difference among k2 and kBehavior described in Figure four. Moreover, the distinction involving k2 and k3 at all investigated pH values (see Table…
O testLi et al. eLife 2015;four:e05896. DOI: ten.7554eLife.three ofResearch articleComputational andO testLi et al. eLife
O testLi et al. eLife 2015;four:e05896. DOI: ten.7554eLife.three ofResearch articleComputational andO testLi et al. eLife 2015;4:e05896. DOI: ten.7554eLife.three ofResearch articleComputational and systems biology | Ecologywhether S. cerevisiae could use xylodextrins,…
Xy-PTIO, which prevents the extracellular accumulation of NO. PGE2 -G had no impact on EPP
Xy-PTIO, which prevents the extracellular accumulation of NO. PGE2 -G had no impact on EPP amplitude inside the presence of carboxy-PTIO (mean EPP amplitude was 97 ?three of baseline, P…
D PGM activity staining. Separation gel 7.5 [T]. 35 mg proteins were loaded per
D PGM activity staining. Separation gel 7.5 . 35 mg proteins were loaded per lane. 1?Col-0, two?pgm3, three?pgm2, four?pgm1, five?pgm3 pgm1, six?pgm2 pgm1. B, Evaluation of floral stems improvement in…
Protocol. Rather, we introduced a protection protocol to discover, whether or not the H3 Receptor
Protocol. Rather, we introduced a protection protocol to discover, whether or not the H3 Receptor Antagonist MedChemExpress agonist and its antagonist occupy the same binding websites no less than at…
Supplements are readily available for BRD3 custom synthesis figure two: Figure supplement 1. Xylosyl-xylitol oligomers
Supplements are readily available for BRD3 custom synthesis figure two: Figure supplement 1. Xylosyl-xylitol oligomers generated inSupplements are accessible for figure two: Figure supplement 1. Xylosyl-xylitol oligomers generated in yeast…
Foundation, Chennai, in 1994 has made a substantial contribution in this path.[3] Even so, only
Foundation, Chennai, in 1994 has made a substantial contribution in this path. Even so, only two of total kidneys for renal transplantation are procured from deceased renal SSTR2 review donors…
As imply 6 SEM. NT: no treatment. doi:10.1371/journal.pone.0106153.gPLOS One particular | plosone.orgMicroRNA-29b Modulates Innate and
As imply 6 SEM. NT: no treatment. doi:10.1371/journal.pone.0106153.gPLOS One particular | plosone.orgMicroRNA-29b Modulates Innate and Adaptive ImmunityOur hypothesis is that beta-cell miRNAs like miR-29b impact autoimmune responses by recruiting innate…
Cholesterol in plasma is largely derived from systemic effects on HDL and independent of macrophage
Cholesterol in plasma is largely derived from systemic effects on HDL and independent of macrophage LXR activity. Our benefits indicate that LXR activation can increase the cholesterol acceptor activity of…
F covariate measurement errors, hence allowing additional realistic models to beF covariate measurement errors, therefore
F covariate measurement errors, hence allowing additional realistic models to beF covariate measurement errors, therefore allowing far more realistic models to be ROCK2 Compound constructed. Consequently, we chose a tiny…
Eep into the binding pocket by means of a hydrophobic linker.Supporting InformationFigureEep in to the
Eep into the binding pocket by means of a hydrophobic linker.Supporting InformationFigureEep in to the binding pocket through a hydrophobic linker.Supporting InformationFigure S1 The Ca root mean squared deviations (RMSD)…
Imary antibody (two g ml-1 rabbit anti-COX-2 polyclonal antibody #AB5118, Millipore Corporation, Billerica, MA, USA)
Imary antibody (two g ml-1 rabbit anti-COX-2 polyclonal antibody #AB5118, Millipore Corporation, Billerica, MA, USA) for 12?4 h at 4 C. Muscles were then rinsed for 1 h in BS,…
Rbonyl molecule which readily reacts with certain proteins and enzymes and disrupts their structure and
Rbonyl molecule which readily reacts with certain proteins and enzymes and disrupts their structure and function . MG is of wonderful pathological significance since it is usually a major precursor…
Rmined NPY Y2 receptor Antagonist Purity & Documentation utilizing a kit from Epigentek. DNMT activity
Rmined NPY Y2 receptor Antagonist Purity & Documentation utilizing a kit from Epigentek. DNMT activity assay. DNMT activity in the nuclear extract was determined using kits from Epigentek, following the…
Conformational states and characterize their thermodynamic properties, including the pKasConformational states and characterize their thermodynamic
Conformational states and characterize their thermodynamic properties, including the pKasConformational states and characterize their thermodynamic properties, for example the pKas of titratable groups. Because of this, rather than analyzing a…
Supplements are readily available for Caspase list figure 2: Figure FGFR manufacturer supplement 1. Xylosyl-xylitol
Supplements are readily available for Caspase list figure 2: Figure FGFR manufacturer supplement 1. Xylosyl-xylitol oligomers generated inSupplements are obtainable for figure two: Figure supplement 1. Xylosyl-xylitol oligomers generated in…
Contractions recorded from the| Brain 2013: 136; 3766?F. Wu et al.Figure 1 In vitro contraction
Contractions recorded from the| Brain 2013: 136; 3766?F. Wu et al.Figure 1 In vitro contraction assay demonstrates a beneficial impact of bumetanide (BMT) throughout a Raf Formulation hypokalaemic challenge. Tetanic…
Of template DNA from a WT mouse sample was included on each plate for both
Of template DNA from a WT mouse sample was included on each plate for both the telomere and also the 36B4 reactions to facilitate ATLR calculation. Ct values had been…
Lla anatum A1 cells infected by E15vir nonsense mutants, then incubating the irradiated 10K supernatants
Lla anatum A1 cells infected by E15vir nonsense mutants, then incubating the irradiated 10K supernatants with E15 "heads" obtained by infecting Salmonella anatum A1 with E15 (am2), an E15 nonsense…
At cells (S1 Figure). Using an antibody against pan-phosphorylated serine (p-SerAt cells (S1 Figure). Making
At cells (S1 Figure). Using an antibody against pan-phosphorylated serine (p-SerAt cells (S1 Figure). Making use of an antibody against pan-phosphorylated serine (p-Ser) to detect the PDE11 Source proteins immunoprecipitated…
Esult in variable efficacies of inhibition (one hundred ) that may well prove to becomeEsult
Esult in variable efficacies of inhibition (one hundred ) that may well prove to becomeEsult in variable efficacies of inhibition (one hundred ) that may perhaps prove to be worth…
Ation of your CD45 phosphatase. Boosting reduction capacity in vitro enhances RA T cell function,
Ation of your CD45 phosphatase. Boosting reduction capacity in vitro enhances RA T cell function, CD45 phosphatase activity and decreases Lck phosphorylation Incubation with N-acetyl cysteine (NAC) (one hundred lM)…
Ecific body odorants activate many segments in the CD40 Activator medchemexpress brain's reward circuitry such
Ecific body odorants activate many segments in the CD40 Activator medchemexpress brain's reward circuitry such as the mOT (unpublished observations), AcbC, AcbSh, along with the ventral tegmental location (VTA) .…
Ty acids (PUFA) and red meat, but higherCorresponding author: Zora Djuric, Ph.D., 1500 E. Medical
Ty acids (PUFA) and red meat, but higherCorresponding author: Zora Djuric, Ph.D., 1500 E. Medical Center Drive, Area 2150 Cancer Center, University of Michigan, Ann Arbor, MI 48109-5930, Phone: 734-615-6210…
Ote AF through enhanced RyR open probability, diastolic SR Ca2 leakOte AF by means of
Ote AF through enhanced RyR open probability, diastolic SR Ca2 leakOte AF by means of enhanced RyR open probability, diastolic SR Ca2 leak, and delayed afterdepolarizations . Here we recognize…
A)three and H8BINOL-derived phosphorus amidite ligand L9 (Scheme 10).22 A rangeA)3 and H8BINOL-derived phosphorus amidite
A)three and H8BINOL-derived phosphorus amidite ligand L9 (Scheme 10).22 A rangeA)3 and H8BINOL-derived phosphorus amidite ligand L9 (Scheme 10).22 A number of readily available terminal olefins might be efficiently C-H…
A-Bestmann reagent (0.238 g, 1.24 mmol) dissolved in MeOH (two mL), and powdered K2CO3 (0.240
A-Bestmann reagent (0.238 g, 1.24 mmol) dissolved in MeOH (two mL), and powdered K2CO3 (0.240 g, 1.74 mmol) had been stirred at 0 . Following the Thymidylate Synthase Inhibitor Biological…
T Arabidopsis was expectedly more rapidly compared using the perennial host, cassava, comparisons between equivalent
T Arabidopsis was expectedly more rapidly compared using the perennial host, cassava, comparisons between equivalent early, middle and late stages revealed a similar pattern for the two most over-represented categories…
Uently around the advancement of edema and ascites, or even the accumulation of fluid during
Uently around the advancement of edema and ascites, or even the accumulation of fluid during the stomach cavity. The mechanism by which extra sodium and fluid induce ascites formation is…
A pKa = 5.1 upon substrate binding (i.e.,Figure 7. Proton-linked equilibria forA pKa = 5.1
A pKa = 5.1 upon substrate binding (i.e.,Figure 7. Proton-linked equilibria forA pKa = 5.1 upon substrate binding (i.e.,Figure 7. Proton-linked equilibria for the enzymatic activity of PSA at 376C.…
Ue from 3 rats with thalamostriatal CXCR6 medchemexpress terminals immunolabeled for VGLUT2 andUe from 3
Ue from 3 rats with thalamostriatal CXCR6 medchemexpress terminals immunolabeled for VGLUT2 andUe from 3 rats with thalamostriatal terminals immunolabeled for VGLUT2 and striatal spines and den-drites immunolabeled for D1,…
Ege, Liege, Belgium; 3Developmental Neurobiology Unit, GIGA-Neurosciences, GIGA-R, University of Liege, Liege, Belgium; 4Walloon `
Ege, Liege, Belgium; 3Developmental Neurobiology Unit, GIGA-Neurosciences, GIGA-R, University of Liege, Liege, Belgium; 4Walloon ` Excellence in Life Sciences and Biotechnology (WELBIO), Wallonia, Belgium; 5Animal Facility, University of Liege, CHU,…
N this pathway are acyl-CoA dehydrogenases, which are known to haveN this pathway are acyl-CoA
N this pathway are acyl-CoA dehydrogenases, which are known to haveN this pathway are acyl-CoA dehydrogenases, which are recognized to possess undergone frequent gene duplication and horizontal transfer events ,…
Inside the failure power of collagen fiber bridges in presence ofIn the failure energy of
Inside the failure power of collagen fiber bridges in presence ofIn the failure energy of collagen fiber bridges in presence of aneurysm and subsequent propensity on the tissue to dissect.NIH-PA…
T inflammatory responses in macrophages (44). Therefore, Hdac7-u is likely to promote the expression of
T inflammatory responses in macrophages (44). Therefore, Hdac7-u is likely to promote the expression of a subset of HDAC-dependent, TLR4inducible, proinflammatory genes in macrophages. The in vivo functions of Hdac7…
We studied for the initial time Ca2-handling properties in pAF.We studied for the first time
We studied for the initial time Ca2-handling properties in pAF.We studied for the first time Ca2-handling properties in pAF. Although the incidence of SCaEs is improved in both pAF and…
Igures 4A and 4B). Comparable to YF, HAHA was also expressedIgures 4A and 4B). Comparable
Igures 4A and 4B). Comparable to YF, HAHA was also expressedIgures 4A and 4B). Comparable to YF, HAHA was also expressed at sub-physiological BRD4 Formulation levels when introduced into liver…
Lal-/- CD4+ T cells also showed Virus Protease Molecular Weight improved potential of transendothelial migration,
Lal-/- CD4+ T cells also showed Virus Protease Molecular Weight improved potential of transendothelial migration, with comparable final results as Ly6G+ cells (Figure 1B). Several adhesion molecules happen to be…
A graded acetone/ ethanol series (33 , 50 , 66 , one hundred acetone;
A graded acetone/ ethanol series (33 , 50 , 66 , one hundred acetone; 20 min every step). Cells had been then infiltrated with Spurr's resin in acetone (33, 66,…
Ficantly enhanced quantity of colony-forming unit-fibroblasts (CFU-F) at primary culture, and also a 40
Ficantly enhanced quantity of colony-forming unit-fibroblasts (CFU-F) at primary culture, and also a 40 higher cell number at first passage under hypoxia (five O2) compared with normoxia.47,48 In another study,…
Ered that the numbers of patients at TXA2/TP drug intense BMI was smaller sizedEred that
Ered that the numbers of patients at TXA2/TP drug intense BMI was smaller sizedEred that the numbers of individuals at extreme BMI was smaller inside the present study and may…
Iosciences Institute (JHDC, NLG and YSJ) and by a pre-doctoral fellowshipIosciences Institute (JHDC, NLG and
Iosciences Institute (JHDC, NLG and YSJ) and by a pre-doctoral fellowshipIosciences Institute (JHDC, NLG and YSJ) and by a pre-doctoral fellowship from ^ CNPq and CAPES through the program `Ciencia…
The membranes by the addition of ndodecyl--d-maltoside (DDM; Anatrace) to aThe membranes by the addition
The membranes by the addition of ndodecyl--d-maltoside (DDM; Anatrace) to aThe membranes by the addition of ndodecyl--d-maltoside (DDM; Anatrace) to a final concentration of 20 mM. Insoluble material was removed…
Sical process mainly because of higher mechanical strength and biodegradation price (16). 1-ethyl-Sical process since
Sical process mainly because of higher mechanical strength and biodegradation price (16). 1-ethyl-Sical process since of high mechanical strength and biodegradation price (16). 1-ethyl-3-(3-dimethyl aminopropyl) carbodiimide hydrochloride (EDC)N-hydroxysuccinimide (NHS) is…
Participant donated around five mL blood, of which 2 mL was used for genomic DNA
Participant donated around five mL blood, of which 2 mL was used for genomic DNA extraction. The response price was approximately 95 for stomach cancer subjects and 92 for controls.…
Hanism underlying insulin resistance, diabetes, and cardiovascular illness? The widespread soil hypothesis revisited. Arterioscler Thromb
Hanism underlying insulin resistance, diabetes, and cardiovascular illness? The widespread soil hypothesis revisited. Arterioscler Thromb Vasc Biol 24(five):816?23 Prentki M, Nolan CJ (2006) Islet beta cell failure in form 2…
Tor axonal neuropathy (AMAN; Devaux et al., 2012). AMAN may be the most predominant kind
Tor axonal neuropathy (AMAN; Devaux et al., 2012). AMAN may be the most predominant kind of GBS in China and Japan, and is characterized by comprehensive axonal degeneration. Most sufferers…
Ogue 15 (see Scheme 3). To additional shorten the synthesis, attempts had been createdOgue 15
Ogue 15 (see Scheme 3). To additional shorten the synthesis, attempts had been createdOgue 15 (see Scheme 3). To additional shorten the synthesis, attempts have been created to directly apply…
H PPAR activation in adipocytes may underlie its pharmacological functions, asH PPAR activation in adipocytes
H PPAR activation in adipocytes may underlie its pharmacological functions, asH PPAR activation in adipocytes may well underlie its pharmacological functions, as adiponectin contributing to insulin-sensitizing and antiatherogenic effects is…
Em [1,2] that impacts approximately 400,000 people within the USA and two.1 million folks worldwide
Em that impacts approximately 400,000 people within the USA and two.1 million folks worldwide . Relapsing emitting MS (RRMS) will be the most common kind of MS, affecting around 80?5…
S to NO was unchanged.Endothelium-derived NOTo evaluate the contribution of endothelium-derived NO in vascular relaxation,
S to NO was unchanged.Endothelium-derived NOTo evaluate the contribution of endothelium-derived NO in vascular relaxation, we inhibited NPY Y1 receptor Antagonist site EDH-mediated relaxations by depolarizing the vessels with higher…
Nce Exercisesaerobic workouts: 15s/15s at 120 of maximal aerobic pace (MAS) and an integrated
Nce Exercisesaerobic workouts: 15s/15s at 120 of maximal aerobic pace (MAS) and an integrated training on the HTE in extremely qualified soccer players. All players performed three operating sessions in…
On formation inside the aortic sinus [22]. These outcomes suggest that adiponectinOn formation in the
On formation inside the aortic sinus . These outcomes suggest that adiponectinOn formation in the aortic sinus . These benefits suggest that adiponectin expression in atherosclerotic lesions may perhaps play…
Of Na. Information are from triplicate datasets, along with the error barsOf Na. Data are
Of Na. Information are from triplicate datasets, along with the error barsOf Na. Data are from triplicate datasets, and also the error bars represent SEM.Functional characterization of VcINDYsingle succinate-binding web…
AblyGenetics, Vol. 197, 497?Junebe harnessed to provide precise option therapeutic targets for MAPK pathway-associated illness
AblyGenetics, Vol. 197, 497?Junebe harnessed to provide precise option therapeutic targets for MAPK pathway-associated illness intervention. On the other hand, if MAP3Ks act cooperatively to fine tune a response, then…
Are out there with the on the internet version of this article.Differentially Expressed Proteins in
Are out there with the on the internet version of this article.Differentially Expressed Proteins in Chronic Active Hepatitis, Cirrhosis, and HCC Associated with HCV Infection in Comparison With HBV Infection:…
Of S. spinosa Lu106 exhibited a growth defect relative to that of the wild kind.
Of S. spinosa Lu106 exhibited a growth defect relative to that of the wild kind. In addition to, the entry into stationary phase of rex mutant was delayed relative to…
Me lines, RNAi silencing of autophagy genes was linked with elevatedMe lines, RNAi silencing of
Me lines, RNAi silencing of autophagy genes was linked with elevatedMe lines, RNAi silencing of autophagy genes was linked with enhanced viral replication and mortality right after infection of flies,…
H di-tert-butyldiaziridinone (1) and Pd(PPh3)four led to a novel sequential allylicH di-tert-butyldiaziridinone (1) and Pd(PPh3)four
H di-tert-butyldiaziridinone (1) and Pd(PPh3)four led to a novel sequential allylicH di-tert-butyldiaziridinone (1) and Pd(PPh3)four led to a novel sequential allylic and aromatic C-H amination course of action, providing a…
Ly of each and every other in the HOXA cluster, and that the loss of
Ly of each and every other in the HOXA cluster, and that the loss of PRC2 recruitment in ASXL1-deficient cells did not outcome from inactivation of PR UB. A extensive…
Y either be brought on by a decreased δ Opioid Receptor/DOR Inhibitor review translation or
Y either be brought on by a decreased δ Opioid Receptor/DOR Inhibitor review translation or perhaps a decreased stability on the multisubunit Cascade complicated. A considerably decreased translation need to…
Kin Elmer, Waltham, MA). Digital micrographs had been taken RSK2 supplier making use of a
Kin Elmer, Waltham, MA). Digital micrographs had been taken RSK2 supplier making use of a NikonKin Elmer, Waltham, MA). Digital micrographs were taken working with a Nikon Inverted Scope Eclipse…
Were operated repeatedly. 2.three. Analysis of Profiles of Cecal Bacterial and BacterialHad been operated repeatedly.
Were operated repeatedly. 2.three. Analysis of Profiles of Cecal Bacterial and BacterialHad been operated repeatedly. two.three. Analysis of Profiles of Cecal Bacterial and Bacterial Enzymes. The resection was carried out…